Details for Capsella Locus Carubv10014622m

Position : scaf_3 ( 5`- 5823011 .. 5824725 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014622m

Protein [Map View]
MVSLKLQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEAKRKGRHSGYGK
RKGTREARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLSDQFE
AKRAKNKASRERKFARREERLAQGPGGGETAPAAEPAPQQAEATKKKSKK*

DNA
ATGGTGTCGCTCAAGCTCCAGAAGCGGCTCGCCGCATCCGTGATGAAATGCGGGAAGGGAAAAGTCTGGCTCGATCCCAA
TGAGTCTGGCGATATCTCTATGGCCAATTCCAGGCAGAACATTAGGAAGCTTGTGAAAGATGGTTTCATTATCAGGAAGC
CTACCAAGATCCACTCGCGTTCTCGGGCTAGGGCTTTGAACGAGGCCAAGAGGAAGGGTCGTCACTCTGGATACGGTAAG
AGAAAGGGTACAAGAGAGGCAAGGCTACCAACCAAGATTCTGTGGATGAGGAGAATGAGGGTGTTGAGGCGTTTCCTGAG
CAAGTACCGTGAGTCAAAGAAGATTGACAGGCACATGTACCATGACATGTACATGAAAGTGAAGGGTAACGTTTTCAAGA
ACAAGCGTGTGCTGATGGAGAGCATCCACAAGATGAAGGCTGAGAAGGCAAGAGAAAAGACTCTTTCTGACCAGTTTGAG
GCCAAGCGCGCTAAGAACAAGGCTAGCAGGGAGAGGAAGTTTGCCAGAAGAGAGGAGAGATTAGCTCAGGGACCTGGAGG
AGGAGAAACAGCTCCTGCTGCTGAGCCAGCACCTCAACAAGCAGAGGCAACCAAGAAGAAGTCGAAGAAGTGA