Details for Capsella Locus Carubv10014616m

Position : scaf_3 ( 5`- 2190868 .. 2191804 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014616m

Protein [Map View]
NPTLSQRATLFTKLFHPFSPPLKLRNSLRQTLLGRRMSNISPIFPIPDSQHFSDYGFDPQVHYFQVMEEARKHKRETWAK
SSMNNGLQFKIQKPISKDDPTRSTMHTNKRKKRCWWKKALPFFKWRKWPVAAGLNEDRRARNFRTVTGSMSGPIYATESL
STPYRASTNRHSSGPIAGTLTPGRAIPYLSLRELNMEQPQRISICSSPIYLVT*

DNA
AACCCCACACTCTCCCAACGGGCAACTCTCTTCACAAAGCTCTTTCATCCATTTTCTCCGCCATTAAAGCTCCGGAACTC
CCTACGACAGACATTGCTAGGAAGAAGGATGTCCAACATTTCCCCAATATTCCCCATCCCCGATTCTCAACATTTCAGCG
ACTATGGCTTCGATCCTCAAGTCCACTACTTTCAGGTTATGGAGGAAGCGAGAAAGCATAAGAGAGAAACATGGGCAAAG
TCATCCATGAACAACGGTCTTCAATTCAAGATCCAAAAACCCATTTCGAAAGATGACCCGACCCGATCCACGATGCACAC
CAACAAGAGGAAGAAACGGTGCTGGTGGAAAAAGGCTCTCCCTTTCTTCAAATGGCGGAAATGGCCTGTCGCCGCCGGCT
TGAACGAAGATCGTAGAGCTAGGAACTTTCGAACCGTAACCGGATCGATGTCTGGTCCGATTTACGCAACGGAGAGTCTG
AGCACACCGTACCGTGCAAGTACAAATAGACATTCGTCAGGACCTATAGCGGGAACATTAACGCCAGGGAGGGCGATCCC
GTACCTGAGTTTACGAGAGCTTAACATGGAACAGCCACAGAGGATTTCTATCTGCTCTTCCCCCATTTACTTGGTCACGT
AA