Details for Capsella Locus Carubv10014614m

Position : scaf_3 ( 5`- 4365520 .. 4366715 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014614m

Protein [Map View]
MAESTQMEVETAAQTVTLPAKPTFKPLKAHEMSDGKVQFRKISVPPNRYSPLKKAWLDIYTPIYDQMKVDIRMNLKARKV
ELKTRADTPDISNLQKAADFVHAFMLGFDIPDAISLLRMDELYVESFEIKDVKTLKGEHLSRAIGRLSGKGGKTKFAIEN
STKTRIVIADTRIHILGAFSNIKVARSSLCSLIMGSPAGKVYSKLRSVSARLNE*

DNA
ATGGCAGAGTCTACTCAGATGGAAGTTGAGACAGCAGCACAGACTGTGACGTTACCGGCTAAACCAACCTTCAAGCCTTT
GAAGGCTCATGAAATGTCTGATGGTAAAGTTCAATTCAGGAAAATATCAGTACCTCCAAACCGATACTCTCCTCTCAAGA
AAGCATGGTTAGATATCTACACACCCATCTATGATCAGATGAAGGTTGACATTAGGATGAATCTTAAAGCCCGTAAAGTC
GAGCTTAAAACCCGAGCTGACACTCCGGACATCAGTAATCTGCAGAAGGCTGCGGATTTTGTACACGCTTTTATGCTGGG
TTTTGATATCCCTGATGCTATCTCTCTTCTGAGAATGGATGAGCTGTATGTTGAGTCTTTTGAGATCAAGGATGTCAAGA
CTCTGAAAGGCGAGCATTTGTCTCGGGCCATCGGGAGATTGTCTGGGAAAGGAGGGAAGACAAAGTTTGCTATTGAGAAC
TCGACCAAGACTAGGATTGTGATTGCAGACACTAGGATTCATATCTTAGGAGCTTTCTCCAATATTAAAGTCGCAAGGAG
TTCACTTTGCAGTCTTATAATGGGATCTCCAGCTGGTAAAGTTTACTCGAAGCTCAGATCTGTCTCTGCTAGATTAAACG
AATAG