Details for Capsella Locus Carubv10014607m

Position : scaf_3 ( 5`- 9452735 .. 9455096 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014607m

Protein [Map View]
MNIFRLAGDMTHLASVLVLLLKIHTIKSCAGVSLKTQELYAIVFATRYLDIFSSFVSLYNTSMKLVFLGSSFSIVWYMRH
HKAVHRTYDREQDTFRHWFLVLPCLLLALLIHEKFTFLEVLWTFSLYLEAVAILPQLVLLQRTRNIDNLTGQYIFLLGGY
RGLYILNWIYRYFTEPHFVHWITWIAGLVQTLLYADFFYYYFLSWKNNKKLQLPA*

DNA
ATGAACATATTCAGATTAGCTGGTGATATGACTCACCTGGCCAGTGTTCTGGTCTTGCTTCTCAAGATCCACACCATCAA
ATCCTGCGCTGGTGTCTCATTGAAGACTCAAGAGCTCTATGCCATTGTCTTTGCTACACGTTATTTGGATATTTTCTCGA
GTTTCGTGTCTCTCTACAACACCTCTATGAAGTTGGTGTTTTTAGGAAGTTCCTTTTCGATTGTTTGGTACATGAGGCAT
CATAAAGCTGTCCACAGGACTTACGACAGGGAGCAAGATACGTTTCGTCATTGGTTCCTTGTGCTTCCTTGCCTACTCTT
AGCTCTTTTGATTCATGAGAAGTTTACCTTTCTAGAGGTACTGTGGACGTTTTCATTGTACTTGGAGGCTGTTGCCATAT
TACCTCAGCTTGTCTTGCTGCAAAGGACTAGAAATATTGACAACTTGACCGGGCAATATATCTTTCTCCTTGGGGGTTAC
CGTGGATTATACATCCTCAACTGGATCTACCGTTACTTCACTGAGCCGCACTTTGTTCACTGGATAACATGGATCGCCGG
ACTTGTTCAAACACTGCTCTATGCCGACTTCTTCTATTATTATTTCCTAAGCTGGAAGAACAACAAAAAGCTCCAGCTAC
CAGCTTAA