Details for Capsella Locus Carubv10014600m

Position : scaf_3 ( 5`- 7289246 .. 7290941 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014600m

Protein [Map View]
MAIAKMILLKLTYGVSFRILGLIFVMSRTIKRVLLGSFIFILASVSVVVASIVGAIEGHTTDIGFLQGGLLGVVAGVITA
VQLFGPVLHSDQPLAKVALLRRVVNGKAIMGLVRPFVLKAYQWQIIALDTSYMESSDLYDFNQERKGLSKSSIQNIPMFY
NHSDHQTKSSCPICLQDWEEGEVGRKLERCGHTFHMICIDEWLLKQETCPICRDHLS*

DNA
ATGGCCATTGCTAAGATGATTCTTCTGAAACTCACATACGGTGTTTCTTTTCGGATTCTTGGTCTGATCTTCGTAATGTC
AAGAACGATAAAGCGAGTTTTGTTGGGTTCATTCATCTTCATTCTTGCTTCCGTTAGTGTTGTGGTAGCCTCCATTGTAG
GAGCCATCGAAGGTCACACCACTGACATCGGATTCCTTCAAGGTGGTTTGCTAGGAGTCGTGGCTGGAGTTATCACCGCG
GTCCAACTCTTTGGACCAGTGTTACATAGTGATCAACCTTTGGCTAAGGTGGCTTTACTTAGGAGGGTAGTGAATGGGAA
AGCCATCATGGGTTTGGTTAGACCGTTTGTTCTCAAAGCATATCAATGGCAAATAATAGCATTGGACACAAGTTACATGG
AGAGTTCGGACTTGTACGATTTCAACCAAGAAAGAAAAGGGTTATCAAAGAGCTCTATTCAGAACATCCCAATGTTTTAC
AACCATTCAGATCATCAAACAAAATCGAGTTGTCCGATTTGCTTACAGGATTGGGAAGAAGGGGAAGTAGGAAGAAAGCT
AGAGAGATGTGGCCACACGTTCCATATGATTTGCATAGATGAGTGGTTGCTTAAGCAAGAGACTTGCCCCATTTGTAGAG
ACCATCTTTCATAA