Details for Capsella Locus Carubv10014599m

Position : scaf_3 ( 5`- 7372302 .. 7373182 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014599m

Protein [Map View]
MDQDRERGRSCCGCCLSFIFTAGLTSLFLWLSLRADKPKCSIQNFYVPALNKTLNSRVNTTLNFMVRCDNPNRDQGVYYD
DVRLTLSTANTTNTNSSAPPLFVGNYTVPRFYQGHKKKAKKWGQVSPLNNQTVLRAVFPNGSAVFRLDLKTQVRFKIVFW
KTKRYGIDVGANVEVNGDGVKPNKKGIKMRKNDSSFPLSRISFPICVLMNLLLFFAIR*

DNA
ATGGATCAAGACAGAGAACGTGGAAGAAGCTGTTGTGGCTGCTGCTTGAGCTTCATCTTCACAGCAGGACTCACCTCTCT
CTTCTTATGGCTCAGTCTCCGTGCCGACAAACCCAAATGCTCAATCCAAAACTTTTACGTCCCTGCCCTCAACAAAACCC
TGAATTCACGGGTCAATACCACTCTCAACTTCATGGTTCGTTGCGACAATCCGAACAGAGACCAAGGAGTCTACTACGAC
GATGTCCGCCTCACCTTATCCACCGCCAACACGACCAACACCAACTCCTCTGCTCCTCCCCTCTTCGTTGGCAACTACAC
AGTGCCTAGGTTCTACCAGGGACACAAGAAGAAGGCCAAGAAGTGGGGTCAGGTTTCGCCGTTGAACAACCAGACGGTTT
TACGAGCGGTTTTTCCTAATGGATCGGCGGTTTTCAGGTTGGATCTGAAGACTCAGGTGAGATTCAAGATTGTGTTCTGG
AAAACTAAGAGGTATGGGATTGATGTTGGTGCTAATGTTGAAGTCAACGGTGATGGAGTCAAACCTAATAAGAAAGGGAT
TAAGATGAGGAAAAATGATTCTTCTTTTCCATTATCAAGAATCTCTTTCCCTATTTGTGTTTTGATGAATTTGCTACTCT
TCTTCGCCATTCGTTGA