Details for Capsella Locus Carubv10014574m

Position : scaf_3 ( 5`- 2081993 .. 2084191 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014574m

Protein [Map View]
MASLISDTEPPTTSTTTDLVRRKKKRSSVSSAASSRTSAASVSCESHTRWRSEKQQRIYSAKLIQALQQVRLNNSSAEAT
SSPTAQKRGRAVREAADRALAVSARGRTLWSRAILANRIKLKFRKQKRPRATTAIPVTTTVVSSSNRSRKRRVSVLRLNK
KSIPSVNRKVRVLGRLVPGCGKQSVPVILEEATDYIQALEMQVRAMNSLAQLLSSYGSAPPPI*

DNA
ATGGCGTCTCTGATCTCAGATACAGAACCGCCGACGACGAGTACTACTACAGATCTCGTTCGGAGGAAGAAGAAGAGATC
CTCTGTTTCATCCGCCGCGTCGTCTCGTACAAGCGCAGCTTCCGTCTCCTGTGAGAGCCACACGCGATGGAGATCCGAGA
AGCAACAACGCATCTACTCCGCCAAGCTGATCCAAGCGCTGCAGCAAGTCCGCCTCAACAACTCTTCAGCCGAGGCGACA
TCATCTCCAACGGCTCAGAAACGAGGCAGAGCCGTACGTGAAGCCGCGGACCGAGCTCTCGCCGTTTCCGCTCGCGGGAG
AACGCTCTGGAGCAGAGCCATCTTAGCTAATAGGATCAAACTGAAGTTCCGTAAACAGAAACGTCCGAGAGCGACGACGG
CGATCCCGGTCACGACCACGGTGGTGAGTAGCAGCAACAGATCGAGAAAAAGAAGAGTGTCGGTGTTGAGATTGAATAAG
AAGAGTATACCGTCGGTGAACCGGAAAGTTCGTGTTCTAGGCCGGTTAGTTCCGGGTTGCGGGAAACAATCAGTACCGGT
GATTCTAGAAGAAGCAACAGATTACATTCAGGCTCTGGAGATGCAAGTCAGAGCCATGAACTCTTTAGCTCAGCTTCTCT
CCAGCTACGGCTCTGCTCCTCCGCCGATTTGA