Details for Capsella Locus Carubv10014564m

Position : scaf_3 ( 5`- 2170848 .. 2172668 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014564m

Protein [Map View]
MDSNSWINCPSVFSSARRCQSRSDLYIGGGGGGGYEDLEGEDHDLNAEFICPFCAEDFDIVGLCCHIDEEHPVEAKNGVC
PVCTKRVGLNIVGHITTQHANFFKVQRKRRLRRGGYSSTYLALKKELREANLQSLLGGSSSFTSSTNIDSDPLLSSFMFN
SPSVNESANKTATPATEGNSATKVSYRESLKRDIQEAPLSGEDQEKAKKSEFVRGMLWSTMLGDDF*

DNA
ATGGATTCCAATTCATGGATCAATTGTCCCTCTGTTTTCTCTTCTGCGAGACGGTGTCAATCCCGATCAGATTTGTACAT
AGGAGGAGGAGGAGGAGGAGGGTACGAGGATCTTGAAGGAGAAGACCACGATTTGAATGCTGAGTTTATATGCCCGTTTT
GCGCAGAGGATTTTGACATTGTTGGGCTTTGTTGCCACATTGATGAAGAACATCCTGTTGAAGCCAAGAACGGGGTTTGT
CCTGTATGCACTAAGAGGGTGGGATTGAATATCGTTGGCCATATTACGACGCAACATGCCAATTTTTTTAAGGTTCAGCG
AAAGAGAAGGTTGCGAAGAGGAGGATATAGCTCTACCTATCTCGCCTTGAAAAAGGAACTCCGGGAAGCAAACTTACAGT
CTCTTCTTGGTGGTTCTTCAAGTTTTACTTCTTCAACCAATATCGATTCTGATCCGCTGCTGTCATCCTTTATGTTTAAT
TCTCCTTCAGTTAATGAGTCTGCAAACAAAACTGCTACACCTGCGACTGAAGGAAACTCGGCTACAAAAGTCTCGTATAG
AGAATCTCTCAAAAGAGATATTCAAGAAGCTCCGCTTTCAGGTGAAGATCAAGAGAAGGCGAAAAAGAGCGAGTTTGTGC
GGGGTATGTTGTGGTCAACCATGCTTGGAGACGATTTCTAA