Details for Capsella Locus Carubv10014555m

Position : scaf_3 ( 5`- 1387141 .. 1389019 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014555m

Protein [Map View]
MWSSRTLKYIIRLRPEPISSLSSSAHLLSRGPLLPSQHRSITSTAPLHGWMDSIKGVFTGNKDTPVEESNLPVEAFTLLR
FADELKNARRLGKFKQYIVGRSSEATFAEAFEKQEAVIRYLGALDVTGENLKASQKQDAAKHCKCTITDVENTLAKFTWA
RQAHKKMAELKEGGKPLPKNMGELQKMMGSTPLDLARSNLAKSGQISRNALCPCGSKKRYKRCCGKD*

DNA
ATGTGGTCTTCAAGAACTCTCAAGTATATTATCAGGTTAAGGCCTGAACCAATTTCTTCTTTATCCTCTTCTGCGCATTT
GCTCTCTCGAGGTCCTTTACTTCCGTCGCAGCACCGATCAATTACCTCCACGGCGCCGCTTCATGGATGGATGGACTCTA
TCAAAGGTGTTTTCACCGGAAATAAGGACACTCCTGTGGAAGAATCAAATCTACCCGTTGAAGCTTTCACTCTTCTCCGA
TTTGCTGATGAGTTGAAGAATGCTAGAAGGTTAGGAAAATTTAAGCAGTACATTGTGGGTAGAAGCAGCGAGGCCACATT
TGCAGAGGCGTTTGAGAAACAAGAAGCTGTTATTCGGTATCTCGGAGCTCTTGATGTTACAGGAGAGAATCTCAAAGCCA
GTCAGAAACAAGATGCTGCTAAACATTGCAAGTGCACAATAACGGACGTCGAGAATACGCTGGCCAAGTTTACTTGGGCC
AGGCAAGCTCACAAGAAGATGGCAGAGTTGAAAGAAGGAGGCAAACCGTTACCAAAGAATATGGGAGAGCTGCAAAAAAT
GATGGGGTCAACACCGCTGGATCTGGCGAGATCAAACTTAGCGAAAAGTGGGCAGATCAGCCGCAATGCTCTGTGTCCCT
GCGGTTCCAAAAAGAGATATAAAAGATGTTGCGGAAAGGATTGA