Details for Capsella Locus Carubv10014549m

Position : scaf_3 ( 5`- 2176930 .. 2178363 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014549m

Protein [Map View]
MGKIRPGTDPKAALVSDILTLSISPISCIHINRISGSCFIDWYLILGIQEDAEVKLIRKRYHKLALKLHPDKNNHPKADI
AFKLIHEAYLCLSDEAKRRCFNTDRRKNICIKCSSRVSHKTKEKNRSDSKPNRFCQTLRDIRDKFREENKVIERCLKTNS
ARFMGNRTTEESSVYGIPNRNRFNKESPVFNPSDYRLWGYPHVRNRVLDNNLSDWGIFMRSRSTCVHSS*

DNA
ATGGGTAAGATCCGACCCGGAACGGATCCGAAAGCGGCATTGGTCTCAGATATTCTAACCCTATCCATATCACCAATCTC
TTGCATTCATATCAACCGCATCTCCGGTTCGTGTTTCATCGACTGGTATCTCATTCTCGGTATCCAGGAAGATGCAGAGG
TCAAGCTCATACGTAAACGATATCACAAATTAGCTTTGAAGCTTCATCCCGATAAAAACAATCACCCAAAAGCAGATATT
GCTTTTAAGCTCATCCACGAGGCTTACTTATGTCTTTCAGACGAAGCAAAGAGAAGATGCTTCAACACGGACCGAAGAAA
GAACATTTGCATAAAATGCAGCAGCCGAGTCTCGCACAAAACCAAAGAGAAGAACCGTAGCGATTCCAAGCCGAACCGGT
TCTGTCAAACCCTCAGGGACATAAGGGACAAGTTCAGAGAGGAGAACAAGGTGATAGAGAGGTGTCTAAAAACAAATAGT
GCAAGATTCATGGGGAACAGAACAACAGAGGAAAGCTCTGTTTATGGTATACCAAACCGAAACCGGTTTAATAAAGAGTC
GCCTGTGTTTAACCCATCAGATTACAGGTTATGGGGTTATCCACATGTGAGAAATCGGGTGTTGGACAACAACTTGTCGG
ATTGGGGCATTTTTATGAGAAGCAGATCCACTTGTGTTCACTCATCCTGA