Details for Capsella Locus Carubv10014542m

Position : scaf_3 ( 5`- 4823900 .. 4826204 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014542m

Protein [Map View]
MGSNNNENLYAVLGLKKECTTTELRSAYKKLALRWHPDRCSSMDFIEEAKKKFQAIQEAYSVLSDSNKRFLYDVGAYNTD
DDDDQNGMGDFLSEMAAMMNQSKPSENNTGDSFEQLQDLFNEMFQGDAAAFSSSSSSSSCSTSTFTSSCSFVFDTNAQQS
SSFDTSSVGMNDPFGFDPRAHHTFSLGVDHQQDFKKGKNNGGRRNNRRKNNVPSAGHETSSSNNFGVPTS*

DNA
ATGGGGTCGAATAATAACGAGAATTTGTATGCTGTTCTCGGTTTGAAGAAGGAATGTACCACCACGGAGCTCCGCTCTGC
TTATAAGAAGCTTGCTCTTAGATGGCATCCGGATCGTTGTTCGTCAATGGACTTTATTGAAGAAGCAAAGAAGAAATTTC
AGGCTATCCAAGAAGCTTACTCTGTTCTGTCTGACTCCAACAAGAGGTTCCTGTATGATGTTGGAGCTTATAATACTGAT
GATGATGATGACCAAAATGGAATGGGAGACTTCTTGAGTGAAATGGCGGCTATGATGAATCAATCCAAGCCTAGTGAGAA
TAACACAGGGGATAGTTTTGAACAGCTACAAGATCTGTTTAATGAGATGTTTCAAGGAGACGCTGCTGCATTCTCATCAT
CATCGTCATCATCATCTTGCTCCACTTCAACGTTCACTTCCTCTTGTAGTTTTGTATTTGATACAAACGCACAGCAGTCA
TCGTCATTCGATACAAGTTCAGTGGGGATGAATGATCCTTTTGGATTTGACCCTAGAGCTCATCATACCTTCTCTTTAGG
GGTTGACCATCAGCAGGATTTCAAGAAAGGGAAGAACAATGGCGGAAGAAGAAACAATAGAAGGAAGAACAATGTCCCAT
CAGCTGGTCACGAGACATCGTCATCAAACAACTTTGGAGTCCCCACCTCATAA