Details for Capsella Locus Carubv10014539m

Position : scaf_3 ( 5`- 472103 .. 474168 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014539m

Protein [Map View]
MGCVSSCFRVEDIDDYMNPNSSVYRNCPCIRCLAHNFLNLYVSVFRRGETRSLPSSVQATASMTSSSSHDNFLSEAFRST
PRPLPYDADPRYFRSLISRREKGSSHSHDEAEPLRSDSDADSESFGAGGCKWANSKSTISDKDSKEEYSSKSSLRILKSK
SKSVMVDSENMYILSEDEDVCPTCLEEYTSENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFNETP*

DNA
ATGGGATGTGTTTCTTCTTGCTTTCGGGTAGAAGACATTGATGACTACATGAATCCAAATAGCTCTGTGTATAGGAACTG
TCCCTGCATTAGATGCCTTGCTCATAATTTCCTTAACTTGTATGTCTCGGTCTTCAGAAGAGGGGAAACCCGCTCTCTCC
CATCTTCGGTTCAAGCTACTGCATCGATGACTTCCTCTTCTTCGCACGATAACTTTCTGTCTGAAGCATTCCGTTCTACA
CCAAGACCTCTCCCTTATGATGCTGATCCTAGATATTTCCGTTCACTCATCTCAAGACGGGAGAAGGGTTCAAGTCATTC
CCATGATGAAGCTGAACCTTTAAGAAGTGATAGCGATGCAGATTCTGAATCTTTCGGGGCTGGAGGATGCAAATGGGCTA
ACAGTAAGTCCACCATTTCTGATAAAGATTCCAAAGAAGAGTACTCTAGTAAATCCAGTCTCAGGATTTTGAAATCAAAG
TCAAAATCAGTAATGGTAGACTCTGAAAACATGTATATACTGTCTGAAGATGAAGATGTTTGTCCAACTTGTCTTGAAGA
ATATACATCGGAGAACCCAAAGATTGTGACAAAATGTTCTCACCATTTCCACCTTAGTTGCATTTATGAGTGGATGGAGC
GAAGTGAAAACTGTCCTGTCTGCGGAAAGGTGATGGAGTTCAATGAAACACCGTGA