Details for Capsella Locus Carubv10014520m

Position : scaf_3 ( 5`- 4055401 .. 4058456 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014520m

Protein [Map View]
MMMKSRFSFFFFFFVIVFSLSLFISPLIASELGFCNGDMALLGGVRDVPANQNSGEVESLARFAVDEHNKKENALLEFAR
VVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKPWLNFKELQEFKPASAITPSDLGCKKDEHGSGSREVPGDDPEVL
HVAEHAVKTIQQRSNSLFPYELKEVVHASAEVTGEAAKFNMLLKLKRGDKEEKFKVEVHKNHEGDLHLNHMEQHHD*

DNA
ATGATGATGAAAAGCCGTTTCTCATTCTTCTTCTTCTTCTTCGTCATCGTTTTCTCTCTCTCCCTCTTCATTTCCCCTCT
GATCGCCAGTGAGTTAGGCTTTTGTAACGGCGACATGGCTTTACTCGGCGGCGTTCGCGATGTCCCTGCTAATCAGAACA
GTGGTGAGGTCGAGAGCCTCGCTCGTTTCGCTGTTGATGAGCATAACAAGAAAGAGAATGCACTTCTTGAGTTTGCGAGA
GTGGTGAAGGCCAAAGAACAAGTTGTGGCCGGAACACTGCATCACCTCACTCTGGAGATTCTCGAGGCTGGGCAGAAGAA
GCTTTACGAAGCAAAAGTGTGGGTGAAGCCTTGGTTGAACTTCAAGGAGTTACAGGAGTTCAAGCCTGCCAGTGCCATTA
CCCCCTCTGATCTTGGCTGCAAGAAAGATGAACATGGATCGGGATCGAGGGAAGTTCCCGGAGATGATCCTGAAGTGCTG
CACGTTGCTGAGCATGCTGTCAAGACCATCCAGCAGAGGTCTAACTCCTTGTTCCCCTACGAACTTAAGGAGGTTGTGCA
TGCTAGCGCTGAGGTAACTGGCGAGGCTGCAAAATTCAACATGCTTTTGAAGTTGAAGAGGGGAGACAAAGAGGAAAAGT
TCAAGGTGGAAGTCCACAAGAACCACGAAGGTGATCTTCATCTCAACCACATGGAGCAACACCATGACTAG