Details for Capsella Locus Carubv10014517m

Position : scaf_3 ( 5`- 2534035 .. 2535379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014517m

Protein [Map View]
MATLKASILLKTLDSDISGDVLSDLGRRGSGAVHVIMGPMFSGKSTSLLRRVKSEISAGRSVAMLKSSKDTRYAKDSVVT
HDGIGFPCWALPDLMSFPHKFGQDAYNKLDVIGIDEAQFFGDLYEFCCKVADEDGKTVIVAGLDGDYLRRSFGAVLDVIP
IADSVTKLTARCEVCGQKAFFTLRKTCDTRTELIGGADVYMPVCRKHYITNHIVIKASKKVLEDSDKARAESCVAAII*

DNA
ATGGCCACTCTCAAAGCTTCGATTTTGCTCAAAACCCTCGACAGTGACATCTCCGGAGATGTTCTTTCCGATCTGGGACG
TCGTGGATCCGGTGCTGTTCATGTTATTATGGGTCCTATGTTTTCTGGGAAATCGACCTCTCTTCTCCGCCGAGTCAAGT
CAGAGATCAGCGCCGGGAGAAGTGTTGCGATGCTGAAATCGAGTAAGGATACGAGATACGCCAAAGATTCGGTGGTGACA
CATGATGGAATTGGATTCCCTTGCTGGGCTCTTCCAGATCTCATGTCATTTCCTCATAAATTCGGACAAGATGCTTATAA
CAAGCTTGATGTGATTGGTATTGACGAGGCTCAATTTTTTGGAGATCTTTATGAGTTTTGTTGCAAAGTCGCTGATGAAG
ATGGCAAAACAGTGATTGTTGCAGGCCTAGACGGTGACTATTTAAGAAGGAGCTTTGGTGCTGTTCTTGATGTTATACCA
ATAGCTGACTCTGTGACAAAGCTAACGGCAAGGTGTGAGGTTTGTGGACAGAAAGCTTTCTTCACTTTAAGAAAGACTTG
TGATACCAGAACCGAGCTTATTGGTGGAGCTGATGTCTATATGCCTGTTTGTCGCAAGCATTACATCACTAATCACATTG
TCATTAAAGCATCTAAGAAAGTGTTGGAAGATTCTGACAAGGCCAGAGCTGAATCCTGTGTTGCTGCTATTATCTAA