Details for Capsella Locus Carubv10014510m

Position : scaf_3 ( 5`- 6125040 .. 6127841 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014510m

Protein [Map View]
MKALGSTGWKGPVKFRMPTAENLVPIRLDIQFEGQRYKDAFTWNPSDPDNEVVVFAKRTVKDLKLPAAFITQIAQSIQSQ
LTDFRSYEGQDMYTGEKIIPIKLDLRVNHTLIKDQFLWDLNNFESDPEEFARTLCKDLGVEDPEVGPAVAFAIREQLYEI
AIQSVASARESRLSKKGRRGSDHGSASKSSGLSMDLVKLFSFKSSVVRKRKDLDIYEPMVDLLTTEEVDALEAREERHAR
*

DNA
ATGAAAGCTTTAGGGTCGACTGGTTGGAAAGGTCCCGTCAAGTTCAGGATGCCAACTGCTGAAAACTTGGTACCTATTCG
TTTGGACATTCAATTTGAAGGTCAGCGATACAAAGATGCTTTCACTTGGAACCCTTCAGACCCGGATAATGAAGTCGTTG
TCTTTGCCAAAAGAACTGTTAAAGACTTGAAACTTCCAGCTGCATTTATCACTCAGATTGCCCAATCTATTCAGTCTCAG
CTCACAGACTTTCGGTCATATGAAGGACAAGACATGTACACTGGTGAAAAGATCATACCAATCAAGCTTGATCTCCGAGT
TAATCATACCCTCATCAAGGATCAGTTCTTATGGGACCTAAACAATTTTGAGAGTGATCCTGAGGAATTTGCAAGAACCT
TGTGCAAGGATTTAGGTGTTGAAGATCCTGAAGTTGGACCGGCTGTTGCCTTTGCAATAAGGGAGCAACTTTACGAGATT
GCAATTCAAAGTGTGGCTTCAGCTAGAGAGAGTAGATTAAGTAAGAAAGGCCGCAGAGGATCTGATCATGGTTCAGCAAG
CAAGTCAAGTGGCTTGTCAATGGACTTAGTGAAGTTATTCAGCTTTAAGTCCAGTGTAGTTAGGAAAAGGAAAGACTTGG
ATATTTATGAACCAATGGTGGATCTGCTAACAACCGAGGAAGTTGATGCTCTTGAAGCCAGAGAAGAAAGACATGCAAGG
TAA