Details for Capsella Locus Carubv10014509m

Position : scaf_3 ( 5`- 8119775 .. 8120964 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014509m

Protein [Map View]
MITGVLRRSSLPSGQTLSAALTSFDSCLSHHLTPASTAASITPRFTVASSPNSFGITARDFHIRSEPPMFVPAGIVSHGY
ATARESSFRDSKNVGISKTAKVKISPVNVKPLSRKEIALQKEAAEESTSKIKGTKICIAIRSFDNPEKHAWSLPPHTRKV
AMPDTRTLYTVLRSPHVDKKSREQFEMRFKKRLLVIKAQSHELSKKLFWLKRYRILGAQYELQFHCKTRLDMTKVLSNID
*

DNA
ATGATCACCGGAGTACTTCGCCGATCTTCCCTGCCGTCGGGGCAGACACTCTCCGCTGCGTTGACCTCCTTTGATTCATG
TCTTTCTCACCATCTCACTCCAGCCTCCACCGCAGCCTCAATCACTCCTCGATTCACTGTCGCATCGTCTCCGAACTCAT
TTGGTATTACAGCGAGGGACTTCCACATTAGATCTGAGCCGCCGATGTTTGTTCCCGCAGGAATCGTGTCACATGGTTAC
GCCACTGCGCGAGAGAGTAGCTTCAGAGATTCGAAAAATGTTGGTATCAGCAAAACCGCAAAGGTTAAAATTTCTCCAGT
GAATGTCAAACCATTAAGTAGGAAGGAGATCGCTCTCCAGAAAGAGGCAGCAGAAGAAAGCACATCAAAGATAAAAGGAA
CCAAGATTTGCATAGCGATTCGGTCTTTCGATAACCCGGAAAAGCACGCTTGGTCTCTCCCTCCTCACACCCGTAAGGTT
GCAATGCCGGACACAAGGACGCTGTACACTGTGCTACGGTCGCCTCACGTCGATAAGAAGTCTAGGGAACAGTTTGAAAT
GCGGTTCAAGAAAAGGCTTCTTGTCATCAAAGCTCAGAGTCACGAGCTGAGCAAGAAGCTGTTCTGGTTAAAACGTTACC
GTATTCTTGGAGCGCAGTATGAACTCCAGTTCCATTGCAAGACCCGTTTGGACATGACTAAAGTGTTGAGCAACATTGAT
TGA