Details for Capsella Locus Carubv10014508m

Position : scaf_3 ( 5`- 2396899 .. 2398449 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014508m

Protein [Map View]
MSSPSSSLLIFAVAACFLSLISPAISQTSCSTQKLSSAASFDSCQDLPVLDSYLHYSYNASNSSLSVAFVATPSETNGWV
AWAINPTGSNMSGSQAFLAYRSGAGAAPVVKTYNISGYSSLVEGKLAFDFWNLRAESLSGGKIAIYTTVKVPAGADSVNQ
VWQLGGNVTNGRPGVHPFGKDNLSSHRVLRFTADAPGSAPSPATGGSTTKGGPGNAGSLTTKVNFGVNLGIIVLLASIFI
L*

DNA
ATGTCTTCTCCTTCTTCTTCTCTTCTAATCTTTGCCGTCGCTGCTTGCTTCCTCTCTCTGATCTCTCCGGCAATTTCACA
GACTTCCTGCTCCACACAGAAGCTTAGCTCCGCCGCGTCCTTCGATTCTTGCCAGGACCTTCCCGTCCTTGATTCCTACC
TCCATTACTCCTACAATGCCTCGAACTCATCTCTCTCCGTCGCCTTCGTCGCTACACCATCTGAGACCAACGGCTGGGTC
GCTTGGGCTATCAATCCCACGGGGTCTAACATGTCCGGTTCTCAGGCCTTCCTCGCTTACAGATCTGGAGCCGGTGCTGC
TCCCGTCGTGAAGACGTACAACATCAGCGGCTACAGCAGTCTCGTCGAAGGCAAACTCGCCTTCGATTTCTGGAATCTAC
GCGCCGAGTCCTTGAGCGGCGGTAAGATCGCTATTTACACGACGGTTAAGGTTCCGGCGGGAGCTGATAGTGTGAATCAG
GTGTGGCAGCTCGGTGGGAATGTTACCAACGGACGTCCTGGAGTACACCCTTTCGGTAAAGATAATCTCAGCTCACACCG
TGTCCTGAGATTTACCGCCGATGCACCCGGCTCTGCTCCGTCGCCGGCCACCGGTGGCTCAACTACTAAAGGAGGTCCAG
GGAACGCAGGGTCTTTGACGACAAAAGTAAATTTTGGGGTCAATTTGGGAATTATCGTTTTGTTGGCTAGTATTTTTATT
CTCTGA