Details for Capsella Locus Carubv10014507m

Position : scaf_3 ( 5`- 1289722 .. 1292064 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014507m

Protein [Map View]
MINFEATELRLGLPGGNHGGDMAAVKNNGKRGFSETVDLKLNLSSTAMDSVSGAQLEDIKEKDVVKPPAKTQVVGWPPVR
SFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASACAAAAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSS
FTIGNCGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR
S*

DNA
ATGATTAATTTCGAGGCGACGGAGCTGAGGTTAGGCCTTCCTGGTGGGAATCACGGTGGAGATATGGCCGCCGTAAAAAA
TAATGGGAAAAGAGGATTCTCTGAGACCGTTGATCTCAAACTTAATCTTTCATCGACGGCTATGGATTCGGTTTCCGGAG
CTCAGCTCGAGGATATCAAGGAGAAAGACGTCGTTAAACCACCAGCAAAGACACAAGTGGTGGGATGGCCACCGGTAAGA
TCTTTCCGCAAGAATGTCATGTCCGGCCAAAAACCGATCACCGGAGATGCCGTTGAAGGAAACGATAAGACTTCCGGCAG
CAGTGGAGCCACTTCATCCGCCTCCGCATGTGCCGCTGCTGCTGCTGCTGCTTACGTGAAGGTTAGCATGGACGGCGCAC
CGTACCTAAGAAAAATTGACCTGAAACTCTACAAAACTTACCAAGATCTCTCCGACGCCTTAAGCAAAATGTTCAGCTCT
TTTACCATCGGCAACTGTGGACCACAAGGAATGAAAGATTTTATGAACGAGAGTAAATTGATCGATCTTCTAAACGGATC
TGATTATGTTCCAACTTATGAAGATAAGGATGGTGACTGGATGCTCGTAGGAGACGTACCCTGGGAGATGTTTGTTGATT
CATGCAAACGTATACGAATTATGAAGGGATCAGAAGCAATCGGACTTGCTCCAAGGGCATTAGAAAAGTGCAAGAACAGA
AGTTGA