Details for Capsella Locus Carubv10014506m

Position : scaf_3 ( 5`- 5650528 .. 5651364 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014506m

Protein [Map View]
MTSLNSSSSPTSSSSDQSDATTATTATSTHLSEGTPPRENTRKRQRDCSSSSPKHPVYRGVRMRSWGKWVSEIRQPRKKT
RIWLGTFATADMAARAHDVAALTIKGSSAVINFPELASLFPRPVSSSPQDIQAAAAEAAAMVVEEGKTSETETETETETS
SETQPPSESSEEERLEEIVELPNIEEEGRYDESVTSRADMAYSEPLDCWVYPPVLDFYEEISSEFNFVELWSFPPHTELI
N*

DNA
ATGACGTCACTGAACAGCTCATCGTCACCAACTTCATCGTCATCGGACCAATCTGATGCAACTACAGCTACTACTGCAAC
AAGCACCCACTTGTCTGAAGGAACTCCACCCAGAGAAAACACAAGAAAGAGACAAAGGGACTGTTCTTCTTCTTCTCCTA
AGCATCCTGTTTACAGAGGTGTGCGGATGAGAAGTTGGGGCAAATGGGTCTCTGAGATCCGACAACCTCGCAAGAAGACT
CGTATCTGGCTCGGCACTTTCGCCACCGCTGACATGGCGGCTCGTGCTCATGACGTCGCTGCTCTCACCATCAAAGGCTC
CTCCGCCGTCATTAATTTCCCTGAGCTCGCTTCTCTCTTCCCTCGTCCGGTCTCATCTTCCCCGCAGGATATCCAGGCAG
CCGCCGCAGAAGCAGCCGCAATGGTGGTCGAAGAAGGAAAAACGTCAGAGACAGAGACAGAGACAGAGACAGAGACGTCA
TCGGAAACACAGCCGCCGTCGGAATCGTCAGAGGAGGAGAGGCTGGAGGAGATCGTGGAGTTGCCTAACATTGAAGAAGA
GGGGAGGTACGACGAAAGCGTGACGTCACGTGCTGATATGGCTTATTCAGAGCCGTTGGATTGTTGGGTGTATCCTCCGG
TATTGGATTTTTACGAAGAAATCTCATCAGAGTTTAATTTCGTGGAGTTATGGAGCTTTCCTCCTCATACGGAACTGATT
AATTAA