Details for Capsella Locus Carubv10014505m

Position : scaf_3 ( 5`- 7746073 .. 7749803 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014505m

Protein [Map View]
MVVPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVLASQGEPKVYPTMRSAFLS
IVKTRGIKGLYAGLSPTLIEIIPYAGLQFGTYDTFKRWSMVYNQRYRSSSSSSVNQNDSLSSFQLFLCGLAAGTVSKLVC
HPLDVVKKRFQVEGLQRDPKYGARVELNAYKNMFDALGQILRLEGWHGLYKGIVPSTIKAAPAGAVTFVAYELASDWFET
NL*

DNA
ATGGTTGTGCCATATACTTCCATACAATTTGCAGTTTTACATAAGGTGAAGTCTTTTGCCGCTGGTTCATCAAAGGCTGA
AAATCATGCTCAACTGAGCCCTTATCTTTCTTACATCAGTGGAGCACTAGCAGGGTGTGCAGCGACAGTCGGATCATATC
CATTTGACCTATTGCGGACTGTATTGGCTTCACAGGGTGAGCCAAAGGTATATCCAACTATGAGATCAGCTTTTCTGAGT
ATAGTGAAAACTCGTGGAATCAAAGGGTTGTATGCAGGATTGTCCCCAACTTTGATTGAGATCATTCCTTATGCCGGTCT
GCAGTTTGGCACTTACGACACATTTAAACGCTGGAGTATGGTCTATAATCAGCGGTACAGATCTTCTTCATCAAGCTCAG
TTAATCAAAATGATAGCCTTTCGAGCTTTCAGCTCTTCCTCTGCGGTTTAGCTGCTGGTACTGTTTCTAAACTTGTTTGT
CATCCACTCGATGTTGTCAAGAAAAGATTCCAGGTTGAAGGTCTGCAACGGGACCCTAAATATGGAGCCCGAGTAGAGCT
AAATGCTTACAAGAACATGTTTGATGCTTTAGGGCAGATATTAAGATTAGAAGGTTGGCACGGTCTTTATAAAGGCATCG
TTCCATCCACCATTAAAGCCGCACCTGCTGGTGCTGTTACATTTGTTGCCTATGAACTTGCATCTGATTGGTTTGAGACA
AACTTGTAA