Details for Capsella Locus Carubv10014502m

Position : scaf_3 ( 5`- 5173945 .. 5175389 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014502m

Protein [Map View]
MNKSTRIIDIPSPSLATVSASADGELNEDDIFAMDISHAPSRHSPVSSPGQHHHPARQLQRSKSGLKNVEASGILAALPE
SSGNSSYLSHVFHHKPAAVLSTSVSSTASSSSSSGGGASAASSSSSRAIPAAPKPPQERLPFAASCIGGGKYPQSAPVQV
PLMSSAMMNRHKKEFKLTDVVDDDEEEEEEGEMLPPHEIVARSLAQSSLLSCSVLEGAGRTLKGRDLRQVRNAVFRRTGF
ID*

DNA
ATGAACAAAAGCACACGAATCATCGATATCCCCTCACCTTCGTTAGCCACCGTCTCGGCCTCTGCAGACGGTGAGCTGAA
TGAAGACGACATCTTTGCAATGGACATATCTCACGCGCCGTCTCGTCATTCTCCCGTATCGTCTCCGGGGCAACATCATC
ATCCTGCTCGCCAGCTTCAGAGGAGCAAGAGCGGTTTGAAAAACGTGGAAGCTTCTGGTATCCTTGCGGCTCTTCCTGAA
TCCTCTGGAAACAGCAGTTACTTGAGCCATGTCTTTCACCATAAGCCTGCGGCTGTTCTCTCCACTTCTGTCTCCTCCAC
AGCTTCTTCATCGTCTTCTTCTGGTGGTGGTGCATCAGCTGCTTCTTCGTCTTCTTCTCGAGCTATCCCAGCAGCGCCTA
AACCGCCTCAAGAGAGGCTTCCCTTTGCAGCTTCTTGTATAGGTGGTGGGAAGTATCCTCAATCAGCTCCGGTTCAAGTG
CCCTTAATGTCTTCGGCGATGATGAATCGCCATAAGAAGGAATTCAAGCTGACTGATGTGGTGGATGATGATGAGGAGGA
AGAAGAGGAAGGCGAAATGCTTCCGCCTCACGAGATTGTAGCTCGGTCTTTGGCTCAGTCTTCGTTGTTATCTTGCTCTG
TGCTTGAAGGAGCAGGAAGGACACTTAAAGGGAGAGATCTCAGGCAGGTAAGGAATGCTGTTTTCAGAAGAACCGGTTTC
ATAGATTGA