Details for Capsella Locus Carubv10014501m

Position : scaf_3 ( 5`- 1554339 .. 1555299 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014501m

Protein [Map View]
METSKNSTNSSLFQWLGLLEDSDDQPPDSTHPRVITLLASILEKMIKKNKKPLHTRQNKFISLLTSEITLVHIVSRSSVL
IFESHGDRDDEITMFHGSKAPSMSIYRYTERIHRYAQCSPACFVAAFAYILRYLQRPEATSTPRRLTSLNVHRLLITSLL
VAAKFLERKCYNNAYYAKIGGVSTEEMNSLERRFLFDVDFRLNVTTESFEKHCLMLQRETVPCDLRKLRTVLGEITCGCQ
AI*

DNA
ATGGAAACTTCTAAAAACTCCACAAACTCATCACTATTCCAATGGTTAGGTCTTTTAGAAGATTCTGATGATCAACCTCC
TGACTCTACCCATCCTCGAGTCATAACCCTCCTCGCTTCTATCCTTGAGAAGATGATTAAGAAGAACAAAAAACCACTCC
ACACAAGACAAAACAAGTTTATAAGTTTACTAACGTCTGAAATTACTCTTGTGCATATAGTTTCTAGATCCTCCGTTCTT
ATATTTGAATCTCATGGCGACAGGGATGACGAGATCACGATGTTCCATGGCTCAAAAGCACCATCGATGAGCATTTATCG
CTACACAGAGAGAATCCACAGGTACGCTCAGTGTAGCCCTGCGTGCTTCGTGGCAGCTTTCGCCTACATCCTTAGGTATC
TACAGAGACCAGAGGCTACAAGTACGCCTCGTCGTCTAACATCACTCAACGTTCATCGCCTCCTCATTACCAGTCTCTTG
GTCGCAGCCAAATTCTTGGAACGCAAGTGTTATAACAACGCGTATTATGCAAAAATCGGAGGAGTGAGCACTGAAGAGAT
GAATAGTCTGGAGAGAAGGTTCTTGTTCGATGTTGATTTCAGACTAAATGTTACAACGGAGAGTTTCGAGAAGCACTGTC
TAATGTTGCAGAGAGAAACGGTGCCTTGTGATTTAAGAAAACTTAGAACAGTTCTTGGAGAGATAACTTGTGGCTGCCAA
GCGATTTAA