Details for Capsella Locus Carubv10014485m

Position : scaf_3 ( 5`- 3956124 .. 3958543 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014485m

Protein [Map View]
MDVRKRGRPEAGSFNSNGGGFKKSKQEMESYSTGLGSKSKPCTKFFSTSGCPFGENCHFLHYVPGGYNAVSQMTNMGPPM
PQVSRNMGGGGRFSGRGESGPGHVSSFGASATAKISVDASLAGAIIGKGGVSSKQICRQTGAKLSIQDHERDPNLKNIEL
EGTFEQINEASAMVRELIGRLNSAAKKPPGGGGGGGGGGMGSEGKPHPGSNYKTKICERFSKGNCTFGDRCHFAHGEAEL
RRSGIA*

DNA
ATGGATGTTCGTAAGAGAGGACGGCCTGAAGCTGGCTCATTCAACTCCAATGGCGGCGGGTTCAAGAAGTCTAAGCAAGA
GATGGAATCATATTCAACTGGTTTAGGAAGCAAATCGAAGCCATGCACAAAATTTTTCAGCACTTCTGGCTGTCCTTTTG
GAGAGAATTGCCATTTCTTGCATTATGTTCCCGGAGGATACAATGCTGTGTCGCAGATGACAAATATGGGACCACCCATG
CCTCAAGTTTCCAGAAACATGGGTGGTGGAGGGCGATTCTCAGGGAGAGGAGAGTCTGGGCCTGGCCATGTCTCTAGCTT
TGGTGCCTCAGCCACTGCCAAAATCAGTGTTGATGCCTCTTTAGCCGGTGCAATCATTGGAAAAGGTGGAGTCAGTTCAA
AGCAGATATGTCGTCAGACGGGGGCAAAGTTGTCTATACAAGATCATGAGAGAGATCCGAACCTGAAGAATATTGAGCTT
GAAGGAACATTTGAGCAGATAAACGAAGCAAGTGCAATGGTAAGAGAGTTGATTGGGAGGCTGAATTCAGCAGCTAAGAA
ACCACCTGGTGGCGGCGGTGGTGGTGGTGGTGGCGGCATGGGTTCTGAAGGGAAACCACATCCAGGGAGCAACTACAAGA
CAAAGATATGTGAGAGATTCTCAAAAGGAAACTGTACATTTGGCGATAGATGCCACTTTGCTCATGGTGAAGCAGAGCTG
CGAAGGTCAGGAATCGCCTAG