Details for Capsella Locus Carubv10014484m

Position : scaf_3 ( 5`- 4596980 .. 4599295 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014484m

Protein [Map View]
MVILSASTTVRAALDTQPRLPYNPNAPRKVKKNPNSNSFLPPALPAPSPATSISVADLLKRPPSKELPVDVDDTYMGYET
WSPSPPKLEKPRSVFNAASLAFVGDSIYELYARRHFLFPSLSIEDYNDRVRAVVRCEAQYALLKKLVDDDFLTKEERDVL
RWGKNVGSSRTRTRRRAGNAVYNKASSLETLIGYLYLTNGKRLDKIMQKLGFSSDSSTEIIIEEAKPKPTESILPNFILN
EQVVSQ*

DNA
ATGGTGATTTTATCGGCGAGCACCACCGTGAGAGCTGCCTTGGATACACAACCTAGGCTCCCATACAACCCTAATGCGCC
GCGAAAAGTGAAGAAGAACCCTAACAGTAATTCTTTCTTACCGCCGGCGTTACCTGCACCGTCTCCGGCAACCAGCATCT
CCGTCGCCGATTTGCTCAAGCGTCCCCCTAGTAAAGAGTTACCTGTTGATGTTGATGATACTTATATGGGGTATGAGACA
TGGTCTCCAAGTCCACCAAAGTTGGAGAAACCAAGATCCGTCTTCAATGCTGCTTCATTAGCGTTTGTAGGCGATTCCAT
TTATGAGCTATATGCTCGGAGGCATTTTCTGTTCCCTTCCCTAAGTATCGAAGATTATAACGATCGTGTTAGAGCAGTGG
TGCGCTGTGAAGCACAGTATGCATTGCTGAAGAAGCTTGTTGATGATGATTTCCTAACAAAGGAAGAGAGGGATGTGCTC
AGATGGGGAAAGAATGTAGGTTCTTCTAGAACACGCACAAGAAGGCGTGCAGGTAATGCGGTGTATAACAAGGCATCATC
ACTGGAGACACTTATTGGCTATCTATATCTGACAAATGGGAAAAGATTAGATAAAATCATGCAGAAGCTAGGATTCTCAA
GCGATTCATCAACTGAGATCATAATTGAAGAGGCGAAGCCTAAACCAACAGAATCAATCTTGCCAAACTTTATACTCAAC
GAGCAAGTGGTGTCACAGTAG