Details for Capsella Locus Carubv10014482m

Position : scaf_3 ( 5`- 13491903 .. 13493920 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014482m

Protein [Map View]
MSSSSSSSSSSSSSYRFQSGFCPLSSSPSLGNFVERIKDACHFLVSAVLGTIISAILTFFFALVGTLLGALTGALIGQET
ESGFIRGAAIGAISGAVFSIEVFESSLDLWKSDESGFGCLLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQMGAVDSSFD
DQISLFDTGGSKGLTGDLVEKIPKMTITGTNNTDAFENTDSCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLLRHGSC
PMCRRDL*

DNA
ATGTCGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTATAGATTCCAATCTGGGTTTTGTCCTCTTTCGTCAAG
TCCTTCTCTTGGGAATTTCGTCGAACGGATTAAAGACGCTTGTCATTTCCTCGTCTCTGCTGTATTGGGGACCATTATCT
CTGCGATCTTGACCTTCTTCTTCGCTTTAGTGGGCACATTGCTAGGCGCACTTACAGGAGCTTTGATAGGCCAAGAAACT
GAGAGTGGTTTCATTAGAGGAGCAGCAATTGGAGCCATTTCAGGAGCTGTTTTCTCTATTGAGGTCTTTGAATCATCTCT
CGATCTCTGGAAATCCGATGAGTCAGGTTTCGGATGTCTTCTCTATTTGATTGATGTCATTGTTAGTCTTCTAAGCGGGA
GACTTGTACGGGAACGCATAGGTCCTGCAATGCTAAGTGCGGTGCAAAGTCAAATGGGAGCTGTGGATTCATCCTTTGAT
GATCAAATAAGCCTCTTTGATACAGGAGGCTCAAAAGGATTGACAGGAGACCTGGTTGAGAAAATCCCAAAGATGACAAT
TACTGGTACAAATAACACAGATGCTTTTGAGAACACAGACTCTTGTTCTGTTTGTCTTCAGGATTTCCAGCTTGGTGAAA
CAGTTAGAAGCTTGCCTCATTGTCATCACATGTTTCACTTACCCTGCATAGACAATTGGCTCCTCAGGCATGGTTCTTGC
CCAATGTGTAGACGTGACCTTTAA