Details for Capsella Locus Carubv10014480m

Position : scaf_3 ( 5`- 7870636 .. 7872518 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014480m

Protein [Map View]
MSQLMIKNDLSYIYTHTQRNHFKKRNILPFYFGVIPLPLYMMDTFSCNSYEQNQTYDDDIEIDAHDHEHGGGDHQEESGW
TTYLDDFSNQYRTTQHHDEDKSSCSLSGVSPSLVSDAATDAFSGKSYPVNFPGKLKFGRARTKKICEDDSLEDTASSPVN
SPKVSQFEHIQTPPRKLEDYVSSSFVMGNIRGMGDHHHHQIQIQEGEQNMTMMRNLREGNNNNNMDLRSRGLCVVPISML
ANFNGRF*

DNA
ATGTCTCAACTAATGATAAAAAACGACCTTTCTTATATATACACACATACACAACGCAACCACTTCAAAAAAAGAAATAT
ACTCCCATTTTATTTCGGTGTTATTCCTCTTCCTCTCTACATGATGGATACATTCTCTTGTAACTCATATGAACAAAACC
AAACATATGATGATGATATTGAGATTGATGCTCATGATCATGAGCATGGTGGTGGTGATCATCAAGAAGAGAGTGGATGG
ACAACTTATCTTGACGATTTCTCAAATCAATACAGAACTACTCAGCATCATGATGAAGACAAGAGTTCTTGCTCGCTCTC
TGGTGTCTCTCCTTCTCTTGTCTCTGATGCTGCCACGGATGCTTTCTCCGGCAAGAGCTATCCGGTTAATTTTCCGGGGA
AATTGAAGTTTGGGAGAGCAAGAACCAAAAAGATTTGTGAGGATGATTCTTTGGAGGATACGGCTAGCTCTCCGGTCAAC
AGCCCTAAGGTCAGTCAGTTTGAACATATTCAGACGCCTCCTAGAAAACTTGAGGACTATGTCTCTTCTAGTTTCGTTAT
GGGAAACATTAGAGGCATGGGGGATCATCATCATCATCAAATCCAAATACAAGAAGGTGAACAAAACATGACGATGATGA
GAAATCTCAGAGAAGGAAACAACAACAATAACATGGATTTGAGGAGTAGAGGATTATGCGTCGTCCCTATATCAATGTTG
GCTAATTTCAACGGTCGCTTCTGA