Details for Capsella Locus Carubv10014477m

Position : scaf_3 ( 5`- 583037 .. 588232 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014477m

Protein [Map View]
MGFLSNKISRDEVKPGDHIYSWRQAYVYAHHGIYVGDGQVNHFTRGDGQETGTGTFLDKIIVSSSHNHGDSPCPNCGDRS
NLGGVISSCLECFLAGGDLYVFEYSVSPAIFLAKPRGGICTIASSDPPEEAIYRANFLLRNGFGVYNVFKNNCEDFAIYC
KTGLLVANTDVGRSGQAASIVAAASVLLSSPLRFVAGFGGLAVAGYGMYCASRLVSDIGMRWDVSKVPVERLVADKSEME
AKPEDMKTT*

DNA
ATGGGATTTCTCTCCAATAAAATCTCCAGAGACGAAGTGAAACCAGGCGATCACATCTATTCATGGCGTCAGGCCTATGT
TTACGCTCATCACGGAATCTATGTAGGTGATGGACAAGTCAACCATTTCACTCGTGGGGATGGTCAAGAGACTGGAACTG
GGACTTTCTTGGACAAGATCATTGTTAGTTCATCCCATAATCATGGAGACAGCCCATGTCCTAATTGTGGAGATCGATCC
AATCTTGGTGGTGTCATCTCTTCTTGCCTTGAATGTTTCCTTGCCGGAGGTGATCTCTATGTCTTTGAATACAGTGTCTC
CCCTGCTATTTTTCTTGCCAAACCTCGAGGCGGCATTTGCACTATAGCATCTTCAGATCCTCCAGAAGAAGCCATTTACC
GTGCAAATTTTCTCCTGCGAAATGGTTTTGGTGTGTACAATGTTTTCAAGAACAACTGTGAAGACTTTGCAATCTATTGC
AAAACTGGTTTGCTAGTGGCAAACACCGACGTGGGAAGGAGCGGTCAAGCCGCTTCGATTGTTGCAGCTGCCAGTGTTCT
TCTTTCTTCGCCACTCAGGTTTGTAGCAGGTTTTGGTGGTCTGGCTGTGGCTGGCTATGGCATGTACTGTGCCAGTCGCC
TGGTTTCAGATATAGGCATGCGATGGGATGTGAGCAAGGTGCCTGTGGAGAGACTAGTTGCTGATAAGTCAGAGATGGAA
GCTAAACCGGAAGATATGAAGACCACTTAA