Details for Capsella Locus Carubv10014475m

Position : scaf_3 ( 5`- 7266620 .. 7268774 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014475m

Protein [Map View]
MRKGRGSSVVGPALPVTAGGSVKEPRYRGVRKRPWGRFAAEIRDPLKKSRVWLGTFDSAEEAARAYDTAARNLRGPKAKT
NFPIDCSPSSPLNYHHNQNQNQNQNLCSAAAAPANQNQNQIDPFMDHRLYGGGNFQNQQQQIISRPASSSMSSTVKSCSG
PRPMEAASSSVAKPLHATKRYPRTPPVAPEDCHSDCDSSSSVIDDGDDIASSSSRRKPPFQFDLNFPPLDGVDLFAGATD
DLHCTDLRL*

DNA
ATGAGGAAAGGGAGAGGCTCTTCCGTCGTTGGTCCCGCCCTTCCAGTAACCGCCGGTGGATCTGTGAAGGAGCCGAGGTA
TAGAGGCGTCAGGAAGAGACCTTGGGGTAGATTCGCCGCGGAGATCCGTGATCCATTAAAGAAATCCCGTGTTTGGCTCG
GTACTTTCGATTCCGCCGAGGAAGCTGCACGCGCTTACGACACCGCCGCTCGTAACCTCCGTGGTCCTAAGGCCAAGACC
AATTTCCCGATCGATTGCTCTCCTTCTTCTCCTCTCAACTACCACCACAACCAGAATCAGAATCAGAATCAGAATCTATG
CTCTGCTGCCGCCGCCCCGGCGAATCAGAATCAGAACCAGATCGATCCGTTTATGGACCATCGGTTATACGGCGGAGGTA
ATTTCCAGAACCAGCAGCAGCAGATTATCAGCCGCCCGGCGAGTAGCAGCATGAGCAGCACCGTCAAATCGTGTAGCGGA
CCCAGACCGATGGAGGCCGCGTCTTCGTCGGTGGCGAAGCCGTTACATGCCACTAAGAGATATCCCAGGACTCCACCGGT
GGCTCCGGAGGATTGTCACAGCGATTGCGATTCGTCTTCCTCTGTTATTGACGACGGGGACGATATCGCGTCTTCCTCTT
CCCGCCGGAAACCGCCGTTTCAGTTTGATCTTAATTTCCCGCCGTTGGATGGCGTTGACTTATTCGCTGGCGCCACGGAT
GATCTTCACTGTACCGATCTACGTCTTTGA