Details for Capsella Locus Carubv10014474m

Position : scaf_3 ( 5`- 8451540 .. 8453062 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014474m

Protein [Map View]
MVESERTKHTCLRLEISGADPIFVKGTWYHSRFDISVTDGSSSWICNATEEEVAERAAQWDQPVSEYLELAEQYLGFQQP
DSIYGFSDALEGCKRLSWTFEKEGTKLEWRWKCKPSHDSKKITVGVLDFLMESNIRLSEEVVNKTRSFEKMKSEAEKCLA
QGQKLCKEKTEFEDATYAKFLSVLNAKKAKLRALRDKEDSGKAVEEEESTDKTESFDDSERSDNEQGEEVDSKKATSSKA
RGRKRAAPN*

DNA
ATGGTTGAATCGGAGAGAACGAAACACACATGTCTCCGGCTTGAAATCTCCGGCGCCGATCCGATTTTCGTCAAAGGCAC
TTGGTATCACTCTCGTTTTGATATCTCCGTCACCGATGGCTCCTCCTCTTGGATTTGCAATGCGACGGAGGAGGAGGTGG
CGGAGCGAGCGGCGCAATGGGACCAACCTGTATCGGAGTATTTGGAGCTCGCCGAACAGTACTTAGGGTTTCAACAGCCT
GATTCTATCTATGGTTTCTCTGATGCTCTTGAGGGATGTAAACGGCTCTCTTGGACGTTTGAGAAGGAAGGGACTAAACT
TGAGTGGAGGTGGAAGTGTAAGCCATCTCATGATAGCAAGAAGATCACTGTAGGGGTCTTGGATTTTCTTATGGAGTCTA
ATATAAGGCTAAGTGAAGAAGTTGTGAACAAGACGAGATCGTTTGAGAAGATGAAGAGTGAAGCTGAGAAATGTCTCGCG
CAAGGTCAAAAACTTTGCAAAGAAAAAACAGAGTTTGAGGATGCAACTTATGCCAAGTTTCTATCTGTGTTAAATGCAAA
GAAGGCAAAACTCAGGGCACTAAGGGACAAAGAAGATTCAGGGAAGGCAGTTGAGGAGGAAGAGTCAACAGATAAAACTG
AAAGCTTTGACGACAGTGAAAGAAGTGACAATGAGCAGGGCGAGGAAGTAGACTCAAAGAAGGCAACAAGCAGTAAAGCC
CGTGGCCGGAAAAGAGCTGCACCCAACTAA