Details for Capsella Locus Carubv10014471m

Position : scaf_3 ( 5`- 4154162 .. 4158876 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014471m

Protein [Map View]
MHKLNRNNRDKLQQFVAITGASEKSALQALKASDWHLEAAFDVFYSQPHPRSNAADVRRLEELYNRYKDQYSDMILAEGI
SNLCNELEVEPQDIVTLVLSWHMNAATACEFSKQEFITGLQALGVDSIAKLREKLPFMRSELKDEQKFHDIYNFAFGWAK
EKGQKSLALDTAIGMWQLLFAEREWPLVTHWCDFLQDRHNKAISKDTWAQLLEFSRMVDPVLSNYDAEGAWPYLIDEFVE
YLYDKNVVEK*

DNA
ATGCATAAGTTGAATAGAAACAACCGTGACAAACTTCAGCAGTTCGTGGCTATCACAGGAGCTAGTGAGAAGAGTGCTCT
TCAGGCTCTCAAAGCCAGTGACTGGCACCTTGAAGCAGCGTTTGATGTGTTTTACAGCCAGCCTCACCCAAGAAGCAATG
CTGCTGATGTAAGACGCTTGGAGGAGCTCTACAATAGATATAAAGACCAATATTCTGATATGATTCTGGCGGAGGGTATC
TCGAATCTCTGTAATGAACTTGAGGTGGAACCACAAGACATAGTCACGTTGGTTCTTTCGTGGCATATGAACGCTGCCAC
AGCGTGTGAATTTTCCAAGCAAGAGTTCATCACTGGACTACAGGCGTTAGGTGTAGATTCCATCGCGAAGTTGCGTGAAA
AGCTGCCATTTATGCGTTCTGAGCTTAAAGATGAACAAAAGTTCCATGATATATACAACTTTGCGTTTGGGTGGGCGAAA
GAGAAGGGGCAAAAATCTCTTGCTCTAGACACAGCGATCGGGATGTGGCAGTTGCTCTTTGCAGAAAGAGAGTGGCCGTT
GGTAACTCACTGGTGTGATTTCTTGCAGGATCGTCATAACAAGGCCATATCTAAGGACACATGGGCACAGCTCCTGGAAT
TTTCAAGGATGGTCGACCCTGTGCTGTCGAATTATGATGCAGAAGGAGCATGGCCTTACCTCATTGATGAATTCGTTGAG
TACTTGTATGACAAGAACGTCGTCGAGAAGTGA