Details for Capsella Locus Carubv10014470m

Position : scaf_3 ( 5`- 477510 .. 480288 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014470m

Protein [Map View]
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEV
NNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHI
LLEANRALSVKLEDMIGVRHHHIGGAWEAGDQQNVVYGHHQAHSQGLYQSLECDPTLQIGYGHPVCSEQMAVATQGHNQP
GNGYIPGWML*

DNA
ATGGGAAGAGGAAGAGTAGAGCTGAAGAGGATAGAGAACAAAATCAACAGACAAGTGACGTTTGCTAAGCGTAGGAACGG
TCTGTTGAAAAAAGCTTATGAGCTTTCTGTTCTCTGCGATGCTGAGGTCTCTCTCATCGTTTTCTCCAACCGTGGCAAGC
TCTACGAGTTCTGCAGCACCTCCAACATGCTTAAGACACTGGAAAGGTACCAGAAGTGCAGTTATGGCTCCATTGAAGTC
AACAACAAACCTGCCAAAGAACTTGAGAACAGCTACAGAGAGTATTTGAAGCTGAAAGGTAGATATGAAAATCTGCAGCG
TCAGCAGAGAAACCTACTTGGAGAGGACCTTGGACCTCTGAATTCAAAGGAGCTAGAGCAGCTTGAGCGTCAACTAGACG
GCTCTCTGAAGCAAGTTCGCTGCATCAAGACGCAGTATATGCTTGACCAGCTCTCTGATCTTCAAGGTAAAGAGCATATC
TTGCTTGAAGCCAACAGAGCTTTGTCAGTGAAGCTGGAAGATATGATCGGCGTGAGACATCACCATATAGGAGGAGCATG
GGAAGCCGGTGATCAACAGAATGTTGTCTACGGACATCATCAGGCTCATTCTCAGGGACTATACCAATCTCTTGAATGTG
ATCCCACTTTGCAAATTGGGTATGGCCATCCAGTGTGCTCGGAGCAAATGGCTGTAGCGACGCAAGGTCATAACCAACCA
GGAAACGGCTACATCCCTGGCTGGATGCTATGA