Details for Capsella Locus Carubv10014469m

Position : scaf_3 ( 5`- 8038771 .. 8041303 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014469m

Protein [Map View]
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKMYKIDDHVACAVAGIM
SDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWK
AAAVGANNQAAQSILKQDYKDDATREEAVELALKVLTKTMDSTSLTSEKLELAEVYLTPSGNVKYHVHSPESLTKLLVKH
GVTQPAAETN*

DNA
ATGTCTCGGAGATATGATAGCCGTACTACAATCTTCTCGCCTGAAGGTCGTCTCTACCAGGTTGAGTATGCTATGGAGGC
CATTGGAAACGCTGGTTCTGCAATTGGAATCTTATCCAAAGATGGAGTTGTGTTGATCGGTGAGAAGAAAGTCACTTCAA
AACTTCTTCAAACCTCAACCTCTGCTGAAAAAATGTACAAGATCGATGACCATGTTGCCTGTGCCGTGGCTGGTATAATG
TCTGATGCTAACATTCTCATCAACACTGCTCGAGTCCAAGCTCAACGATACACCTTCATGTACCAAGAGCCCATGCCAGT
TGAACAGCTGGTTCAGTCTCTCTGTGACACAAAGCAGGGCTACACACAATTCGGTGGTCTTCGCCCGTTTGGAGTCTCCT
TTCTTTTTGCAGGATGGGACAAGAACTACGGGTTCCAACTATATATGAGTGACCCAAGTGGCAACTATGGTGGTTGGAAA
GCTGCAGCCGTTGGAGCAAACAATCAGGCTGCTCAGTCTATTCTGAAACAGGACTACAAGGATGATGCAACTAGGGAAGA
GGCTGTCGAGCTCGCCTTGAAGGTTCTGACCAAGACAATGGACAGCACGAGCTTAACATCTGAGAAGCTAGAGCTTGCTG
AGGTGTATCTGACTCCATCCGGGAACGTTAAGTACCATGTTCACTCTCCTGAGTCGCTCACCAAGCTGTTGGTCAAACAT
GGTGTGACTCAACCCGCTGCTGAGACAAACTAA