Details for Capsella Locus Carubv10014468m

Position : scaf_3 ( 5`- 2412391 .. 2414430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014468m

Protein [Map View]
MRLYFESQTSRRKTVMNFVVRRLGSVLPSLRHSSGSQSRLARTEAGQPRRRNKLPSLPFKKKEEKSEWWIVDGEMHEIGD
HIPPRERFTIPRDNIPNKRRKQLREQFMRRTRLVLKESEHEPWCKKYMELYNELRENWERLYWDEGYSKKIASDHANYES
AEEDDEDFNPYRNRRSYSDQAKEQGFNRPMQGDSWEKVNQVRDKFEYDRERRMRDKAFAPMNAAPASEDSRDLNWNAQRR
PFDAERYTRD*

DNA
ATGAGACTTTACTTCGAGTCTCAGACTAGCCGCCGGAAAACAGTCATGAACTTTGTCGTCAGACGACTGGGCTCGGTTTT
GCCGTCGCTACGTCACAGCAGCGGTTCACAGAGCCGACTCGCCAGAACAGAGGCAGGTCAGCCGAGACGGCGAAACAAGT
TGCCTTCTCTTCCGTTCAAGAAGAAGGAAGAGAAATCCGAATGGTGGATCGTGGACGGAGAGATGCACGAGATAGGTGAT
CACATCCCTCCCCGTGAGCGATTCACAATCCCTAGAGATAACATCCCGAATAAACGCCGTAAGCAGCTCCGTGAGCAATT
CATGCGCCGCACTCGCCTTGTCCTTAAAGAATCGGAACATGAGCCATGGTGCAAAAAGTATATGGAACTATATAATGAGC
TTAGAGAGAACTGGGAGAGGCTTTATTGGGATGAAGGATATTCAAAGAAAATTGCGAGTGACCATGCTAATTATGAGTCC
GCTGAAGAAGACGATGAAGATTTTAATCCATACAGGAACAGGCGGTCTTACAGCGATCAAGCCAAGGAGCAAGGGTTTAA
TAGACCTATGCAAGGTGATAGCTGGGAGAAAGTCAATCAAGTCAGAGACAAATTTGAGTATGATAGAGAAAGGAGGATGA
GAGATAAAGCCTTTGCACCAATGAATGCAGCACCGGCCTCTGAAGACTCTAGGGACTTGAATTGGAATGCACAAAGACGA
CCCTTTGATGCTGAGAGATACACTAGAGATTGA