Details for Capsella Locus Carubv10014466m

Position : scaf_3 ( 5`- 2984943 .. 2987115 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014466m

Protein [Map View]
MVKKSYPEVKEEYKKAVERCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHEANNGLDIAVR
LLEPIKGLFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATEGVDHLRNVFGRMGLNDKDIVALS
GGHTLGRCHKERSGFEGAWTQNPLIFDNSYFKEILSGEKEGLLQLPTDKALLEDPHFRPFVERYAADEDAFFEDYAEAHL
KLSELGFADKE*

DNA
ATGGTGAAGAAGAGTTACCCGGAAGTGAAAGAAGAGTACAAGAAAGCTGTTGAGAGATGCAAGAGGAAGCTCCGTGGTCT
TATCGCTGAGAAACATTGTGCTCCCATCGTCCTTCGTCTTGCATGGCACTCGGCTGGGACATTTGATGTGAAGACGAAGA
CGGGAGGACCATTCGGGACGATTAGGCATCCTCAAGAGCTAGCCCATGAAGCTAACAATGGTCTTGATATTGCCGTCAGG
CTTCTTGAGCCTATCAAGGGTTTGTTCCCTATTCTGTCATATGCTGATTTCTACCAGCTAGCTGGAGTTGTTGCTGTTGA
GATCACTGGAGGACCCGAGATTCCTTTCCATCCTGGTAGACTGGACAAAGTTGAGCCACCTCCCGAGGGTCGTCTGCCTC
AGGCCACTGAAGGTGTGGATCATCTAAGAAATGTCTTCGGTCGGATGGGACTCAATGACAAAGATATCGTGGCATTGTCC
GGTGGACACACCTTGGGTCGGTGCCACAAGGAGCGCTCAGGATTTGAAGGAGCATGGACACAAAACCCTCTCATTTTTGA
CAACTCCTATTTCAAAGAGATACTAAGCGGAGAGAAAGAAGGACTTCTTCAACTACCAACAGACAAGGCTCTTCTCGAGG
ATCCTCATTTTCGTCCATTTGTTGAGAGATATGCTGCAGATGAGGATGCCTTCTTCGAAGACTACGCGGAAGCTCATCTG
AAGTTGTCAGAACTTGGGTTTGCTGACAAGGAGTAA