Details for Capsella Locus Carubv10014465m

Position : scaf_3 ( 5`- 3927070 .. 3929086 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014465m

Protein [Map View]
MKTPTRRSKRVDEESEPNVATPRVVLRTRKAKCSKTRAVRVKPEYPLAPSTSEMKLMPPEFFQIDSLDLAPRLLGKFLRR
DNVVLRITEVEAYRPNDSACHGRFGVTPRTAPVFGPGGHAYVYLCYGLHMMLNIVADKEGVGAAVLIRSCSPVTGLETIQ
ERRGLKTEKPVLLNGPGKVGQALGLSTEWSHHPLYSPGGLELLDGGEDVEKIVVGPRVGIDYALPQHVHALWRFAIADTP
WISAPKNTLKPL*

DNA
ATGAAAACGCCGACTCGTCGATCGAAGCGGGTTGATGAGGAATCGGAACCCAATGTTGCAACCCCACGAGTAGTCCTACG
GACGCGAAAGGCAAAGTGCTCCAAGACTCGAGCCGTTCGGGTCAAACCCGAATACCCACTGGCCCCCTCCACCTCCGAGA
TGAAGCTGATGCCTCCTGAGTTCTTTCAAATCGACTCCCTTGACCTTGCGCCACGTTTGCTTGGGAAGTTCCTGAGGAGA
GACAATGTCGTCCTGCGAATTACTGAGGTAGAAGCTTATAGACCAAATGATTCAGCTTGCCATGGACGATTTGGGGTTAC
CCCACGGACTGCACCAGTTTTTGGACCAGGAGGACATGCTTATGTTTATCTATGTTATGGTCTCCATATGATGCTTAATA
TTGTTGCTGATAAGGAAGGAGTTGGGGCTGCTGTTTTGATACGGTCTTGTTCTCCTGTTACCGGACTGGAGACCATACAG
GAGCGCCGTGGCCTGAAAACTGAAAAACCTGTTCTTCTAAATGGACCAGGAAAGGTGGGGCAAGCGCTTGGACTCTCAAC
AGAATGGTCTCATCATCCACTTTATTCTCCTGGAGGATTGGAGCTTCTGGATGGAGGAGAAGACGTGGAGAAAATAGTGG
TTGGTCCTCGCGTTGGGATAGATTACGCATTGCCTCAACATGTTCATGCCTTGTGGAGATTTGCTATTGCAGACACTCCA
TGGATTAGTGCTCCTAAGAACACTCTTAAGCCCCTCTAA