Details for Capsella Locus Carubv10014464m

Position : scaf_3 ( 5`- 6553643 .. 6556788 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014464m

Protein [Map View]
MAIPLPLTSYSPISASSSTSSLSRTSFVPLTPRHRSFFSEQNCSRRVLLSCSSSLSSDNGSAPESMNGNGNGNGNGNGSS
LNGQSSFPRMPSFDGTSKPPLKWRRVLLKVSGEALAGDEEQNIDPKVTMAIAREVAAVTRLGIEVAIVVGGGNIFRGSTW
AGCSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTT
DTAAALRCAESK*

DNA
ATGGCGATTCCGTTGCCTCTCACCTCTTACTCTCCAATCTCAGCTTCTTCGTCTACTTCTTCTCTTTCCCGAACCTCTTT
CGTCCCTCTCACACCTCGCCATCGTAGTTTCTTCTCCGAACAGAATTGTAGTAGACGTGTACTTCTCAGCTGCTCTTCTT
CTTTGTCCTCAGACAACGGTTCAGCTCCAGAGTCCATGAACGGGAACGGAAACGGGAACGGAAACGGGAACGGGAGTAGC
TTAAACGGCCAGTCATCTTTTCCACGAATGCCTTCCTTCGATGGAACATCTAAGCCACCGCTTAAATGGAGAAGGGTTTT
ACTCAAAGTCAGTGGAGAAGCTCTTGCTGGAGACGAGGAGCAGAATATTGATCCAAAGGTTACTATGGCGATTGCAAGGG
AAGTTGCAGCAGTAACTCGACTTGGCATTGAGGTTGCTATTGTTGTTGGGGGTGGAAATATCTTTCGTGGATCCACCTGG
GCTGGGTGCAGTGGCCTTGATCGTTCTTCTGCTGATTATATCGGGATGCTGGCAACTGTGATGAATGCAATATTTCTTCA
GGCGACAATGGAGAGTATCGGCATCCCAACCCGGGTTCAAACTGCTTTCCGCATGTCAGAAGTCGCAGAGCCTTACATAA
GAAGACGAGCAATCAGACATCTAGAAAAAGGCAGGGTTGTAATATTTGCAGCTGGAACAGGCAATCCGTTCTTCACCACC
GATACTGCAGCAGCTCTTCGATGTGCTGAAAGTAAGTAA