Details for Capsella Locus Carubv10014462m

Position : scaf_3 ( 5`- 5305512 .. 5306518 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014462m

Protein [Map View]
MEMKGKYLVTVILLIGTLSVGMCSNRWIRAHATYYGVNDSPASLGGACGYDNPYHAGFGAHTAALSGALFRSGESCGGCY
QVRCDFPADPKWCLRGAAVTVTATNFCPSNNNNGWCNLPRHHFDMSSPAFFRIARRGNEGIVPVFYRRVGCKRRGGVRFT
MRGQGNFNMVMISNVGGGGSVRAVAVRGSKGKTWLQMTRNWGANWQSSGDLRGQRLSFRVTLIDRKTLTFLNVVPSSWWF
GQTFSSRGRQFV*

DNA
ATGGAGATGAAGGGAAAATATTTGGTAACTGTTATTCTCTTGATTGGTACGTTAAGTGTGGGGATGTGTTCCAACCGTTG
GATAAGAGCTCATGCAACGTATTACGGTGTTAATGATAGCCCTGCTTCACTTGGAGGAGCTTGTGGATATGACAATCCGT
ACCACGCCGGATTCGGAGCCCACACGGCGGCCCTAAGCGGTGCACTATTCAGAAGCGGTGAGTCATGCGGTGGGTGCTAC
CAGGTGAGGTGTGACTTCCCCGCAGATCCTAAGTGGTGTCTCCGAGGAGCTGCCGTGACGGTGACGGCTACAAACTTTTG
TCCATCAAACAACAATAATGGTTGGTGCAATCTCCCTCGCCATCACTTTGACATGTCCTCACCAGCTTTCTTCCGCATCG
CACGTCGTGGTAACGAAGGCATTGTTCCCGTCTTCTATCGCCGGGTGGGATGCAAGAGAAGAGGAGGCGTGAGGTTTACG
ATGAGAGGGCAAGGTAACTTCAATATGGTAATGATCTCAAACGTTGGTGGTGGTGGCTCGGTGAGAGCGGTAGCAGTACG
CGGCTCAAAGGGAAAAACTTGGCTTCAGATGACCCGTAACTGGGGTGCTAACTGGCAGAGCTCTGGTGATCTCCGGGGAC
AAAGACTCTCCTTCAGAGTAACTCTTATTGACCGTAAAACGCTGACGTTTTTGAACGTTGTCCCTTCTTCTTGGTGGTTT
GGCCAAACCTTCTCCTCTCGGGGACGCCAATTTGTCTGA