Details for Capsella Locus Carubv10014458m

Position : scaf_3 ( 5`- 2180337 .. 2182855 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014458m

Protein [Map View]
KKTEEKIQQKPKPSPAMALTRRTLATLLNKTLSSSPSSSLSTLSSRSRFALPLLEKVFSARTGLGPCYLSTRLKTSGSGY
SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFTDPKPSEEEMINAYVKTLTSVLGSEEEAKKKIYSVCTSTYTGFGA
LISEELSCKVKGLPGVLWVLPDSYLDVPNKDYGGDLYIEGKVIPRPQYRFTEQRQTRNRSRPRYDRRRETMQVERREPSM
GQANPGEFNKPGA*

DNA
AAAAAGACTGAAGAGAAGATACAACAGAAGCCGAAACCCTCACCGGCGATGGCTCTTACACGGCGCACATTAGCGACACT
CCTAAACAAAACCCTCTCCTCCTCTCCTTCTTCTTCTCTCTCTACGCTCTCTTCTCGTTCTCGATTCGCTTTGCCTCTGC
TTGAAAAGGTTTTCTCAGCCCGTACCGGACTTGGTCCCTGTTACCTCTCGACCCGACTCAAGACATCCGGGTCCGGATAC
TCTCCCCTGAACGATCCTTCGCCGAATTGGAGCAACCGTCCGCCAAAGGAGACGATTCTTCTCGATGGTTGCGATTACGA
GCACTGGCTCATCGTCATGGAGTTCACTGATCCCAAACCAAGTGAAGAAGAAATGATCAATGCTTATGTCAAAACCTTAA
CTTCCGTCCTTGGCAGCGAAGAGGAGGCAAAGAAGAAGATCTACTCTGTTTGCACTTCCACCTACACTGGCTTTGGTGCT
TTGATCTCTGAAGAGCTTTCTTGCAAAGTCAAAGGATTGCCTGGTGTTCTGTGGGTGCTGCCGGATTCATACCTTGATGT
ACCAAACAAAGACTATGGAGGTGACTTGTACATTGAAGGAAAGGTCATACCAAGACCACAGTATAGGTTCACAGAACAGC
GCCAGACTAGGAACCGGTCTAGGCCAAGATATGATAGGCGACGTGAGACAATGCAAGTGGAGAGGAGAGAGCCATCCATG
GGTCAAGCAAATCCAGGGGAGTTCAACAAGCCTGGTGCTTAA