Details for Capsella Locus Carubv10014457m

Position : scaf_3 ( 5`- 6340320 .. 6342561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014457m

Protein [Map View]
MATNNGDVLMLEAAPEAARPWASAANAEIIDALPYIDDDYGNPLIKSEVDRLVEEEMRRSSKKPADFLKDLPPLPKFDFE
NCPTLSKEYERVRAGKPPVRIDFESRYKLEVPPASKKNDDAAWKLSLQKNHRSLQHKMFELENLELMSKHGPELWRQNNH
RLEVFLSRMQRLAQEQNEEIEKVNRERKYHQQTTSYELNALSQEWRQLCVKNMEIQSACAVLETQIESYKKEAAERGWNL
EEKLENVESLKLQ*

DNA
ATGGCGACGAACAATGGGGACGTTTTGATGCTAGAGGCGGCGCCGGAGGCTGCGAGGCCCTGGGCGAGTGCTGCGAACGC
AGAAATTATCGATGCGCTTCCTTATATAGACGACGACTATGGCAATCCATTGATTAAGTCGGAGGTAGACCGCTTGGTGG
AGGAAGAGATGCGCCGGAGCTCTAAGAAGCCAGCTGACTTTCTCAAGGACCTGCCTCCTCTTCCAAAGTTTGATTTCGAG
AACTGCCCAACACTTAGCAAAGAGTATGAGCGTGTTAGAGCTGGGAAGCCTCCTGTGCGGATAGATTTTGAATCCCGATA
CAAGCTTGAAGTGCCGCCTGCTAGTAAGAAAAACGACGATGCTGCCTGGAAGCTGTCTCTTCAGAAGAATCATCGGTCAC
TGCAACACAAGATGTTCGAGCTTGAGAATTTGGAATTGATGTCAAAACATGGTCCAGAGCTCTGGAGACAGAACAACCAT
CGGTTAGAAGTATTCTTGTCCAGAATGCAAAGACTAGCTCAGGAGCAGAATGAGGAAATTGAAAAAGTAAATCGGGAAAG
GAAGTATCATCAGCAAACGACATCATACGAGCTCAATGCTCTATCTCAAGAATGGAGACAGCTATGTGTGAAGAATATGG
AGATCCAGTCTGCTTGTGCCGTGCTCGAGACACAAATCGAGTCTTATAAAAAGGAAGCTGCTGAAAGGGGATGGAACTTA
GAAGAGAAACTAGAGAATGTCGAGTCACTTAAACTGCAATGA