Details for Capsella Locus Carubv10014443m

Position : scaf_3 ( 5`- 4504451 .. 4506051 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014443m

Protein [Map View]
MMRSSSRGGKKPVLSKKTTPCCTKTGMKRGPWTVEEDEILVSFINKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSV
KHGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPLDVNHIHYKPEEEVSGG
QNPLDPNSSSHTDTTVDSGDGATKKSISVFGGEGNYDDFGFCYDDKFSSFLNSLINDDDDPFGNIIPILSQPLQMDDCKD
DIVGASSSLGHNQRKEDL*

DNA
ATGATGAGGTCATCATCACGTGGAGGGAAGAAACCAGTACTGTCCAAGAAAACGACGCCGTGTTGCACGAAGACGGGGAT
GAAGAGAGGACCATGGACGGTGGAGGAGGATGAGATCCTTGTGAGCTTCATAAACAAAGAAGGTGAAGGACGCTGGCGAT
CGCTTCCCAAGAGAGCTGGTTTGCTTCGGTGTGGCAAGAGCTGCCGTCTACGCTGGATGAACTATCTCCGGCCGTCTGTC
AAACACGGCGGTATTACCTCCGATGAGGAAGATCTCATCCTCCGTCTTCACCGCCTTCTTGGCAACCGGTGGTCATTGAT
CGCGGGAAGGATACCAGGAAGGACTGATAATGAAATCAAGAACTATTGGAACACTCATCTTCGTAAGAAACTTTTAAGGC
AGGGCATTGATCCTCAAACCCACAAGCCTCTTGATGTAAACCATATCCATTATAAACCTGAAGAAGAAGTTTCCGGTGGA
CAAAACCCTCTAGATCCTAATTCTAGTTCCCATACGGATACCACCGTCGATAGCGGTGATGGAGCTACCAAGAAGAGTAT
TAGTGTCTTTGGTGGTGAAGGAAACTACGATGACTTTGGTTTCTGCTACGACGACAAGTTCTCATCGTTTCTTAATTCGC
TTATCAACGATGATGATGATCCTTTTGGTAACATTATCCCAATATTATCTCAACCGTTGCAGATGGATGATTGTAAAGAT
GACATAGTTGGAGCGTCGTCGAGCTTAGGACATAACCAGAGAAAAGAAGATTTATAG