Details for Capsella Locus Carubv10014442m

Position : scaf_3 ( 5`- 1663729 .. 1665639 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014442m

Protein [Map View]
MALTQIVNPIICPSCTIPRRFTAISPFKALNPQFSRHPTHALSRRLFLPSVSSIWDAITGGGDSNPREAFAATRRGMQLF
RQGDVAGSVSEFDRAVVLDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEARLHGVDVARKQF
LEVGRDSRPVMREAYNLFKNGGDPEKLVKDFSSGGQASEYFYASLYAGLYYEAEGKSENAKFHITAACGSPYGQRSDDYM
ASLAKVHCLCRNWSSGIV*

DNA
ATGGCACTAACCCAGATCGTGAATCCAATCATATGTCCATCTTGCACAATTCCACGGCGTTTCACGGCAATTTCGCCTTT
TAAAGCCCTAAACCCCCAATTTTCCCGCCACCCAACCCACGCACTGTCTCGCAGACTCTTCCTTCCTTCTGTTTCCTCGA
TATGGGATGCCATAACCGGAGGCGGAGACTCGAACCCTCGTGAGGCCTTCGCAGCAACTCGACGTGGAATGCAGCTCTTC
AGACAGGGTGATGTTGCTGGATCGGTGAGTGAGTTCGATAGAGCTGTTGTATTGGACCCAAGGCAAAAGGCATATCTTTG
GCAACGGGGGCTTTCTCTTTACTATCTAGATAGGTTTGAAGAAGGTGCGGAGCAGTTCCGGATAGATGTTGCTCAGAACC
CAAATGACACAGAGGAGTCTATTTGGTGCTTTCTCTGCGAGGCCCGGCTCCACGGTGTTGATGTTGCACGAAAACAGTTT
CTCGAGGTTGGTAGAGATTCTCGGCCTGTGATGCGGGAAGCTTATAATCTATTCAAGAATGGTGGTGATCCTGAAAAGTT
AGTTAAAGACTTTTCTAGTGGTGGTCAAGCAAGCGAATACTTCTACGCTTCGCTGTATGCAGGGCTCTACTATGAAGCTG
AGGGTAAATCAGAAAACGCCAAGTTTCACATCACCGCGGCTTGTGGATCTCCATATGGGCAGAGGTCTGATGATTATATG
GCTTCACTTGCTAAAGTTCACTGCCTCTGTAGAAACTGGAGCTCCGGTATTGTTTGA