Details for Capsella Locus Carubv10014440m

Position : scaf_3 ( 5`- 2229879 .. 2233978 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014440m

Protein [Map View]
MSCATPALPPSLFTNGSLSSPQSVSMTSSNSLVKVSDSGGYKWRLVIAYDGTKFAGWQYQESPPTIQSVLEKALIHITKL
ERKELHLVGAGRTDAGVHAWGQVAHFVTPINYTSLDSIHAALNGLLPKDIRVREMSAAVPEFHARFSASSKIYRYQIYND
TFMDPFQRHWAFHCAYKLNASKMREAAKLFVGKYDFSAFANATREDGVPDPLKTIYRFDVIQMGSLLQLEVEGSGFLYRQ
VRNMVSSLFSLTAFNTAK*

DNA
ATGAGTTGCGCTACACCTGCGCTTCCTCCTTCACTCTTTACTAATGGTTCTCTCTCGTCTCCTCAGAGTGTCTCCATGAC
GAGCTCAAACAGTTTGGTTAAAGTTAGCGACTCTGGTGGTTATAAATGGCGCCTTGTGATTGCCTACGATGGCACAAAGT
TTGCAGGTTGGCAGTATCAGGAGTCACCACCAACGATCCAATCAGTGTTAGAGAAAGCCTTGATTCACATAACTAAGCTC
GAAAGAAAAGAGCTGCATCTTGTTGGAGCAGGCAGGACCGATGCTGGAGTTCACGCTTGGGGTCAGGTAGCTCATTTTGT
CACTCCTATTAATTATACTAGTTTGGATAGCATTCACGCTGCTTTAAACGGTCTTCTCCCTAAAGATATCCGTGTCAGAG
AGATGAGTGCAGCGGTTCCTGAGTTCCATGCTCGGTTTTCTGCCTCTAGCAAGATTTACCGCTACCAAATATACAACGAT
ACTTTCATGGACCCGTTCCAGCGTCATTGGGCATTCCATTGTGCTTATAAACTGAATGCTTCTAAAATGCGGGAAGCTGC
TAAACTTTTTGTTGGAAAGTATGATTTCTCTGCATTTGCTAACGCTACACGGGAAGATGGAGTACCTGATCCTTTGAAAA
CTATTTACCGCTTTGATGTCATTCAAATGGGATCTCTACTACAGCTTGAAGTTGAAGGTTCAGGCTTTTTGTACAGACAA
GTGAGAAACATGGTTAGTTCCTTATTCTCTCTAACTGCGTTCAACACGGCGAAATAA