Details for Capsella Locus Carubv10014438m

Position : scaf_3 ( 5`- 5629613 .. 5631399 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014438m

Protein [Map View]
MGNLLQNREGSATTHLTPHAFKGKQKQGRQREMFTHFVSLPLATYPELNKNLEAFQNSILGNNNNDKILPVKFQNNLSQM
GIEKSIFVSPKTFHLTVVMLKLENSESVIRAQNILKSISSNVRQALKNRPVFIRLKGLECMNGSLDKTRVLYAPVEEVGH
EGRLLNACHVIIDAFENAGFAGKDAKSRLKLHATVMNASYRRDKSKKMDTFDAREIHKEFGNKDWGTYLIREAHISQRFK
YDPNGYFHCCASLPFPHK*

DNA
ATGGGGAATTTACTTCAGAATCGTGAGGGATCTGCCACTACTCATCTCACACCTCACGCTTTCAAAGGCAAGCAGAAACA
GGGTCGCCAGAGAGAAATGTTTACACACTTTGTGTCACTTCCGTTAGCTACATATCCTGAGTTAAACAAAAATCTTGAGG
CTTTTCAGAATTCTATTTTGGGTAACAACAATAATGATAAGATTCTTCCAGTCAAGTTTCAGAATAATTTATCTCAAATG
GGAATCGAAAAATCGATTTTTGTTTCCCCAAAAACTTTCCATTTGACTGTGGTTATGTTAAAGTTAGAGAACAGTGAATC
TGTGATTAGAGCTCAGAATATTCTTAAGAGTATTTCTTCTAATGTGAGGCAGGCTTTGAAGAACCGACCTGTCTTCATTA
GACTCAAGGGATTGGAATGTATGAATGGATCTTTAGACAAAACCCGTGTTCTCTATGCTCCTGTTGAAGAAGTTGGGCAT
GAGGGTCGCCTGCTAAATGCTTGTCATGTTATCATTGATGCATTTGAAAATGCTGGATTTGCTGGTAAAGACGCAAAGTC
ACGCTTGAAGCTACATGCCACGGTGATGAATGCAAGCTACAGAAGAGATAAAAGCAAAAAGATGGATACTTTTGATGCGC
GAGAGATACACAAAGAGTTTGGGAACAAGGATTGGGGAACATATCTAATCAGAGAAGCTCATATCTCACAACGCTTTAAG
TATGACCCGAATGGCTACTTCCATTGCTGCGCTTCACTGCCTTTTCCACATAAGTGA