Details for Capsella Locus Carubv10014437m

Position : scaf_3 ( 5`- 1214260 .. 1216320 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014437m

Protein [Map View]
NLRLCAIRRFASPMSIPPSSGSSSSSSSSQYTYAANSYYSAPYQPPPQPYVTPSPAVPAPVASIPGATVYPQPAGPLPAV
YAYPQYQQAHQLFQRDAQTITPEALENVKAALASSETEHKAETKKRAIPRKAAGQSWEDPTLSEWPENDYRLFCGDLGNE
VNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFSNPADLAAALKEMNGKYVGNRPIKLRKSSWKERTDQEAAERQ
KHHSNKKQKTVKKSILHK*

DNA
AATCTCCGATTGTGTGCGATTAGGCGTTTTGCTTCTCCGATGTCAATCCCACCGTCTTCAGGTTCTTCTTCTTCATCTTC
CTCGTCTCAATATACATACGCAGCTAATTCTTACTATTCCGCGCCGTACCAGCCTCCTCCACAGCCCTACGTGACGCCTT
CGCCTGCTGTTCCGGCGCCGGTAGCTTCCATTCCCGGAGCCACGGTCTATCCGCAGCCTGCTGGACCGCTTCCTGCCGTC
TACGCTTATCCTCAGTACCAACAGGCTCATCAATTGTTCCAAAGAGATGCACAAACCATCACACCAGAAGCTCTTGAGAA
TGTGAAAGCTGCTTTGGCAAGTAGTGAAACCGAACACAAAGCAGAAACTAAAAAGAGAGCCATTCCTCGTAAAGCTGCTG
GACAGTCTTGGGAGGATCCTACTCTTTCAGAGTGGCCAGAAAATGACTATCGATTGTTCTGTGGTGATCTTGGGAATGAG
GTGAATGATGATGTTCTTTCCAAAGCGTTTGCTCGATTCCCCACCTTCAATATGGCCAAGGTCATTAGAGATAAGCGGAC
TGGAAAAACCAAAGGTTATGGGTTTGTGAGTTTCTCAAATCCTGCGGATCTAGCTGCAGCCCTAAAAGAAATGAATGGTA
AGTATGTCGGAAACCGTCCGATAAAACTAAGAAAAAGCAGCTGGAAAGAGAGAACGGACCAGGAGGCTGCTGAAAGACAA
AAGCATCACAGCAATAAGAAGCAAAAGACAGTGAAGAAGAGCATACTTCACAAGTGA