Details for Capsella Locus Carubv10014434m

Position : scaf_3 ( 5`- 2446701 .. 2450438 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014434m

Protein [Map View]
MAASANPSGNNQEGSSATQKVSSSSAAATNGGAVNSVDNGGNTGAAADNSQTAGALRHNSGISTDWTHEEQSLLEDLLVK
YATEPSVFRYAKIAMKMKDKTVRDVALRCRWMTKKENGKRRKEDHSSRKSKDKKEKATDSSAKSSSHLNVHPNGPSYAPP
MMPIDTDDGISYKAIGGVSGDLLEQNAQMFNQVTSNFSAFQLHENVNILSKARENILAILNDLNDMPEVMKQMPPLPVKV
NEELANSILPPRPSHQMKP*

DNA
ATGGCGGCGAGCGCAAACCCGTCTGGTAACAATCAGGAAGGTTCGTCGGCGACGCAGAAGGTATCGTCTTCTTCAGCGGC
GGCTACAAATGGCGGTGCTGTAAATTCTGTCGATAATGGTGGCAATACAGGCGCGGCGGCGGATAATTCACAGACGGCTG
GCGCGTTGAGGCATAACTCAGGGATCTCTACCGATTGGACTCATGAGGAACAATCTCTATTGGAAGATTTGCTTGTCAAG
TACGCGACAGAACCGTCAGTTTTTCGATATGCGAAGATTGCGATGAAAATGAAGGATAAGACTGTCCGTGATGTTGCGCT
GCGCTGTAGATGGATGACTAAAAAGGAAAACGGGAAGCGTAGGAAAGAAGACCATTCATCGAGGAAAAGCAAAGATAAGA
AAGAAAAAGCTACAGATTCTTCAGCCAAGTCCTCATCTCATTTGAATGTGCATCCTAATGGTCCATCGTATGCTCCGCCT
ATGATGCCTATAGATACCGATGATGGTATTTCATATAAAGCTATTGGTGGTGTGAGTGGAGATCTTCTCGAGCAAAATGC
CCAAATGTTCAATCAAGTTACATCAAATTTCTCAGCTTTCCAGCTACATGAGAATGTCAATATCTTGAGCAAAGCTCGGG
AAAATATCCTCGCAATCTTGAATGACTTGAATGACATGCCAGAGGTTATGAAGCAGATGCCACCTCTTCCGGTGAAGGTG
AACGAAGAGCTGGCAAATTCGATCCTCCCTCCTCGCCCATCCCATCAAATGAAGCCATGA