Details for Capsella Locus Carubv10014433m

Position : scaf_3 ( 5`- 5175644 .. 5176684 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014433m

Protein [Map View]
MGSGWLLRFVICLSRPKINKSKRGNVLSETSNRVKPVGSTSASTNLTAEVAVIRIQKAFRAFKARKRLCSLMSARRFNSL
IQGHTLRNQTSTALKVMHSWCDIQSQIRERRLYMVTQGRLQHKRLENRLKLEIKLQELEVEWCGGSETMEDILAKIQQKE
EATVKRERAMAYAFSHQWRANATQYLGQASFNLGTESWGWSWKERWIAARPWEIRAQCHVSKPIKPAKKPEKLPPNVTKT
KPGLPTTKEVKKFKKPGSG*

DNA
ATGGGATCTGGATGGTTGCTCCGCTTTGTCATCTGTCTAAGCAGACCGAAGATAAACAAATCAAAACGAGGCAACGTACT
TTCTGAAACATCAAACCGTGTCAAACCGGTTGGATCAACCTCTGCTTCCACGAACCTCACCGCAGAGGTCGCTGTTATTC
GCATTCAAAAGGCTTTTCGAGCATTCAAGGCGAGGAAAAGACTATGCAGCTTGATGAGCGCGAGGAGGTTTAACTCGCTG
ATCCAAGGCCATACACTGAGGAACCAAACTTCGACTGCACTCAAAGTGATGCATTCTTGGTGCGATATACAGAGTCAGAT
CAGAGAAAGACGTTTGTATATGGTGACACAAGGTAGACTCCAGCACAAAAGATTGGAGAACCGGTTGAAGCTGGAGATCA
AGCTTCAAGAGCTAGAAGTTGAATGGTGTGGAGGTTCTGAAACAATGGAAGATATTCTAGCAAAGATCCAACAGAAAGAA
GAAGCGACGGTGAAGCGAGAACGAGCAATGGCTTATGCTTTCTCTCACCAGTGGAGGGCTAATGCTACACAGTATCTAGG
TCAAGCTTCCTTTAACCTAGGTACAGAAAGCTGGGGATGGAGTTGGAAAGAACGGTGGATCGCGGCTCGACCTTGGGAGA
TTAGGGCTCAATGCCACGTTAGTAAACCGATCAAACCAGCTAAGAAACCGGAGAAATTACCACCCAATGTGACAAAGACC
AAACCTGGTTTGCCAACCACCAAGGAAGTAAAAAAATTCAAAAAGCCTGGTTCCGGATGA