Details for Capsella Locus Carubv10014432m

Position : scaf_3 ( 5`- 1008594 .. 1011077 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014432m

Protein [Map View]
MDLEDWELLSNNSFKDLDHDEDHHGAVVMDYFLCPSSTQDPPPRSIVVPKKLIQVPIAWEPVLDQDNTKTPNNPGLDPDD
SKQTLSTDSVPSPRVSFKITKETEFADMKIDPPSRITSPLPQIDDDDDDLSKPTALEGGDDVRYKTEVTLEEEDNDIDGS
NNGERLNLWKAGLNGIGAICSFGVAAAAATVCVFFLGHNNNIKISKNKNQMLRFQFYSDDNKRMKEVVNHATKLNEAIFG
MKGVPVVRAQISFGGYYDGL*

DNA
ATGGATCTCGAAGATTGGGAATTACTCTCTAATAACAGCTTCAAGGATCTTGATCATGACGAGGATCATCATGGAGCGGT
GGTGATGGATTACTTCCTCTGCCCATCATCAACTCAAGATCCTCCTCCAAGATCCATAGTGGTCCCCAAAAAGCTTATCC
AAGTTCCCATAGCTTGGGAACCCGTGTTGGATCAAGACAACACCAAGACACCCAACAACCCTGGTCTTGATCCGGATGAT
TCAAAACAGACCCTTTCGACGGACTCTGTTCCGTCACCTAGAGTTTCCTTCAAGATAACGAAGGAGACTGAATTTGCCGA
CATGAAAATTGATCCACCATCGAGGATCACGAGTCCTCTGCCTCAGATCGATGATGATGATGATGATTTGTCGAAACCCA
CTGCTTTAGAAGGAGGAGATGACGTACGATACAAGACAGAAGTTACTCTTGAGGAAGAAGATAATGATATTGATGGTAGT
AATAATGGTGAGAGATTGAATCTATGGAAGGCTGGTCTCAACGGGATTGGAGCTATTTGTTCTTTTGGTGTCGCAGCTGC
TGCTGCTACCGTATGTGTCTTCTTCCTCGGACACAACAACAATATCAAGATTTCTAAGAACAAGAACCAGATGCTAAGGT
TCCAGTTTTACTCCGATGATAATAAGAGGATGAAAGAAGTAGTGAACCATGCAACAAAGCTCAACGAAGCAATATTTGGA
ATGAAAGGTGTTCCAGTCGTAAGAGCTCAAATATCTTTTGGGGGTTACTACGATGGACTTTGA