Details for Capsella Locus Carubv10014430m

Position : scaf_3 ( 5`- 2410677 .. 2411905 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014430m

Protein [Map View]
ILGFIILKKETHKKSYISFSSRGGRTEMATITPLALRSPVLLRPSSASNPTRFHGFNNLPPPSRLFFPLKPFPSLSIQNP
KSIRIAASASPMTPILPAANSTNRSSTLTGSTRSLATLAALTIAVTRVLAQKLSLAIQTSSPVIAEGLRLSLSTAGPVFF
ASLRDRPPGYLNTPLTVVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNVIPPIFDTLDVS
PLLAFAVLGTLGSIVHGSTG*

DNA
ATTTTGGGTTTTATTATCCTGAAAAAAGAGACTCATAAAAAAAGCTATATCTCTTTCAGTTCAAGAGGCGGAAGAACGGA
GATGGCCACCATCACACCTCTCGCTCTTCGCTCTCCGGTTCTTCTCCGTCCTTCATCTGCTTCGAACCCTACCAGATTCC
ATGGCTTCAACAACCTACCACCACCATCGCGTCTCTTCTTTCCCCTTAAACCCTTCCCTTCTCTATCCATCCAAAACCCT
AAATCCATCCGAATCGCTGCGTCCGCTTCGCCGATGACGCCGATCCTCCCGGCGGCGAATTCAACGAATCGCTCATCCAC
ACTCACCGGTTCGACTCGGTCCCTCGCTACTCTCGCGGCTTTGACAATCGCTGTAACCAGAGTCTTAGCTCAGAAACTGT
CGCTCGCAATCCAGACCTCAAGTCCTGTAATCGCGGAAGGGTTACGATTGTCCCTCAGTACAGCCGGACCCGTCTTCTTC
GCGTCGCTCAGAGATCGTCCTCCGGGATACTTGAACACGCCGCTTACTGTGGTTGCGGTGGGGATAAAGAAGTGGTTAGA
CATTTACAGTGGGGTTTTGATGGTTAGGGTTTTGCTCAGTTGGTTCCCTAACATCCCTTGGGAGAGACAGCCTTTGTCTG
CCATTAGAGATCTCTGTGATCCTTACTTGAATCTCTTCAGAAATGTCATTCCTCCTATCTTCGATACGCTTGATGTTAGT
CCGTTGCTTGCTTTCGCTGTTCTGGGCACTCTCGGATCGATTGTTCATGGCAGCACTGGATAG