Details for Capsella Locus Carubv10014429m

Position : scaf_3 ( 5`- 7299999 .. 7302695 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014429m

Protein [Map View]
MEGEESLLDAINEEDGFENMEDVDMVDVEEGEILVEHGLDSGEGRNGDGDGEKDKGGVLGKKSGQDQPNKNKKKKKKKRK
GPVRDKPMSVDWFVRDTCRRLKEKKSYMVYTAVGCLGMAALSDLVNEVEAVETCGGQVTADGSRKRTGGGVLWNIIKARQ
PAAHREIMKKTKEFEKQFRHPNTRPKRDQGISSEGLASANASADEALVNEMYDTPVAEKTESKPQVERKPVHERIRVPVS
YDDLFREVSLDASQAQQSSA*

DNA
ATGGAGGGGGAAGAGAGTCTGTTGGATGCTATTAATGAAGAAGACGGATTTGAAAACATGGAGGATGTTGACATGGTTGA
TGTCGAAGAAGGAGAGATTCTTGTGGAGCATGGTTTAGATTCTGGGGAGGGACGAAATGGTGACGGTGATGGAGAGAAAG
ATAAAGGAGGGGTTTTGGGTAAGAAGAGTGGACAGGATCAGCCAAACAAGAACAAAAAGAAGAAGAAGAAAAAGAGAAAG
GGCCCTGTGAGGGACAAACCCATGAGTGTAGACTGGTTTGTTAGGGATACCTGTAGACGCCTGAAAGAAAAGAAGTCTTA
CATGGTATACACAGCAGTTGGGTGTCTTGGAATGGCTGCCTTAAGTGATCTTGTCAATGAGGTGGAAGCAGTTGAGACCT
GTGGGGGTCAAGTGACTGCTGATGGCAGTAGGAAACGGACAGGTGGTGGTGTATTGTGGAACATCATCAAAGCGAGACAG
CCCGCAGCTCACAGAGAGATTATGAAAAAGACTAAAGAGTTTGAGAAGCAATTTAGGCACCCAAACACGAGGCCGAAAAG
AGATCAGGGTATCTCCTCCGAAGGACTTGCCTCTGCTAATGCATCTGCTGATGAAGCTCTTGTCAATGAGATGTATGATA
CGCCAGTAGCTGAGAAGACTGAATCCAAACCGCAAGTAGAAAGGAAACCTGTTCATGAGAGGATCAGAGTCCCTGTTTCC
TATGATGACCTTTTCAGAGAAGTTTCTTTGGATGCTTCACAAGCACAACAGTCTTCTGCTTAA