Details for Capsella Locus Carubv10014428m

Position : scaf_3 ( 5`- 8888930 .. 8890870 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014428m

Protein [Map View]
MVFLKTRTYVLCSAVLAHFILQEKLHMFGILGCILCVVGSTTIVLHAPHEQKIESVKQIWQLATEPGFLVYSAVIVIVVA
ILIFYYEPRYGKTHMIVYVGICSLMGSLTVMSVKAVAIAIKLTFSGTNQFIYFNTWIFILVVAFCCLLQINYLNKALDTF
NTAVISPVYYVMFTTFTIIASMIMFKDWASQSGLKIATELCGFVTILSGTFLLHKTKDMGNTNSGSGRGSGRGSVSMPRE
TPVFTNSGSARSSSSDKIPS*

DNA
ATGGTTTTCTTGAAAACAAGAACCTATGTTTTATGCAGCGCAGTGCTAGCGCATTTTATTTTGCAAGAGAAACTGCATAT
GTTTGGTATACTTGGTTGCATTCTCTGTGTTGTTGGGTCTACAACTATAGTCTTACACGCACCACATGAGCAGAAGATTG
AATCAGTCAAGCAAATATGGCAGCTTGCTACTGAACCAGGTTTCCTTGTGTATTCTGCCGTGATCGTGATTGTGGTAGCT
ATACTGATCTTCTACTATGAACCGCGATATGGAAAGACTCATATGATAGTATATGTTGGAATCTGTTCCTTGATGGGTTC
TCTTACGGTTATGAGTGTTAAAGCTGTGGCGATTGCGATAAAGCTAACGTTTTCGGGGACGAATCAGTTCATATACTTCA
ACACTTGGATTTTCATTTTAGTAGTTGCGTTTTGTTGCCTTTTACAAATCAACTACTTGAACAAGGCACTGGATACATTC
AACACCGCGGTTATTTCACCGGTTTACTACGTTATGTTCACAACTTTCACCATCATAGCTAGTATGATCATGTTCAAGGA
CTGGGCTTCTCAGAGTGGATTGAAGATTGCAACAGAGTTGTGTGGGTTTGTGACGATTTTGTCAGGAACATTTCTGCTTC
ACAAGACGAAAGACATGGGAAACACTAACAGTGGAAGTGGTCGTGGAAGTGGTCGTGGATCTGTCTCTATGCCTAGAGAG
ACTCCTGTCTTTACCAACTCAGGATCAGCTCGGAGCTCTAGCTCAGATAAAATACCCTCCTGA